KEGG   Homo sapiens (human): 1890Help
Entry
1890              CDS       T01001                                 

Gene name
TYMP, ECGF, ECGF1, MEDPS1, MNGIE, MTDPS1, PDECGF, TP, hPD-ECGF
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
hsa  Homo sapiens (human)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Bladder cancer
Disease
H00469  
Mitochondrial DNA depletion syndrome (MDS)
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hsa00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:hsa00983]
Human Diseases; Cancers; Bladder cancer [PATH:hsa05219]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
22q13.33
AA seq 482 aa AA seqDB search
MAALMTPGTGAPPAPGDFSGEGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAA
VVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGG
VGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQVLLDQA
GCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAA
VFPNQEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPP
DLRDLVTTLGGALLWLSGHAGTQAQGAARVAAALDDGSALGRFERMLAAQGVDPGLARAL
CSGSPAERRQLLPRAREQEELLAPADGTVELVRALPLALVLHELGAGRSRAGEPLRLGVG
AELLVDVGQRLRRGTPWLRVHRDGPALSGPQSRALQEALVLSDRAPFAAPSPFAELVLPP
QQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcagccttgatgaccccgggaaccggggccccacccgcgcctggtgacttctccggg
gaagggagccagggacttcccgacccttcgccagagcccaagcagctcccggagctgatc
cgcatgaagcgagacggaggccgcctgagcgaagcggacatcaggggcttcgtggccgct
gtggtgaatgggagcgcgcagggcgcacagatcggggccatgctgatggccatccgactt
cggggcatggatctggaggagacctcggtgctgacccaggccctggctcagtcgggacag
cagctggagtggccagaggcctggcgccagcagcttgtggacaagcattccacagggggt
gtgggtgacaaggtcagcctggtcctcgcacctgccctggcggcatgtggctgcaaggtg
ccaatgatcagcggacgtggtctggggcacacaggaggcaccttggataagctggagtct
attcctggattcaatgtcatccagagcccagagcagatgcaagtgctgctggaccaggcg
ggctgctgtatcgtgggtcagagtgagcagctggttcctgcggacggaatcctatatgca
gccagagatgtgacagccaccgtggacagcctgccactcatcacagcctccattctcagt
aagaaactcgtggaggggctgtccgctctggtggtggacgttaagttcggaggggccgcc
gtcttccccaaccaggagcaggcccgggagctggcaaagacgctggttggcgtgggagcc
agcctagggcttcgggtcgcggcagcgctgaccgccatggacaagcccctgggtcgctgc
gtgggccacgccctggaggtggaggaggcgctgctctgcatggacggcgcaggcccgcca
gacttaagggacctggtcaccacgctcgggggcgccctgctctggctcagcggacacgcg
gggactcaggcccagggcgctgcccgggtggccgcggcgctggacgacggctcggccctt
ggccgcttcgagcggatgctggcggcgcagggcgtggatcccggtctggcccgagccctg
tgctcgggaagtcccgcagaacgccggcagctgctgcctcgcgcccgggagcaggaggag
ctgctggcgcccgcagatggcaccgtggagctggtccgggcgctgccgctggcgctggtg
ctgcacgagctcggggccgggcgcagccgcgctggggagccgctccgcctgggggtgggc
gcagagctgctggtcgacgtgggtcagaggctgcgccgtgggaccccctggctccgcgtg
caccgggacggccccgcgctcagcggcccgcagagccgcgccctgcaggaggcgctcgta
ctctccgaccgcgcgccattcgccgccccctcgcccttcgcagagctcgttctgccgccg
cagcaataa

DBGET integrated database retrieval system