KEGG   Homo sapiens (human): 1947Help
Entry
1947              CDS       T01001                                 

Gene name
EFNB1, CFND, CFNS, EFB1, EFL3, EPLG2, Elk-L, LERK2
Definition
(RefSeq) ephrin B1
  KO
K05463  
ephrin-B
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Disease
H00458  
Craniosynostosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    1947 (EFNB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   1947 (EFNB1)
Cytokines [BR:hsa04052]
 PDGF family
  Other growth factors
   1947 (EFNB1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  EPHA4, SEK, TYRO1; Eph receptor A4 [KO:K05105]
   1947 (EFNB1)
  EPHB1, ELK, NET; Eph receptor B1 [KO:K05110]
   1947 (EFNB1)
  EPHB2, ERK, DRT; Eph receptor B2 [KO:K05111]
   1947 (EFNB1)
  EPHB3; EPHB3, HEK2, ETK2; Eph receptor B3 [KO:K05112]
   1947 (EFNB1)
  EPHB4; EPHB4, HTK; Eph receptor B4 [KO:K05113]
   1947 (EFNB1)
  EPHB6; Eph receptor B6 [KO:K05114]
   1947 (EFNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
Xq12
AA seq 346 aa AA seqDB search
MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKL
DIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPN
YMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSR
PSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVAL
FAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPS
DIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggctcggcctgggcagcgttggctcggcaagtggcttgtggcgatggtcgtgtgggcg
ctgtgccggctcgccacaccgctggccaagaacctggagcccgtatcctggagctccctc
aaccccaagttcctgagtgggaagggcttggtgatctatccgaaaattggagacaagctg
gacatcatctgcccccgagcagaagcagggcggccctatgagtactacaagctgtacctg
gtgcggcctgagcaggcagctgcctgtagcacagttctcgaccccaacgtgttggtcacc
tgcaataggccagagcaggaaatacgctttaccatcaagttccaggagttcagccccaac
tacatgggcctggagttcaagaagcaccatgattactacattacctcaacatccaatgga
agcctggaggggctggaaaaccgggagggcggtgtgtgccgcacacgcaccatgaagatc
atcatgaaggttgggcaagatcccaatgctgtgacgcctgagcagctgactaccagcagg
cccagcaaggaggcagacaacactgtcaagatggccacacaggcccctggtagtcggggc
tccctgggtgactctgatggcaagcatgagactgtgaaccaggaagagaagagtggccca
ggtgcaagtgggggcagcagcggggaccctgatggcttcttcaactccaaggtggcattg
ttcgcggctgtcggtgccggttgcgtcatcttcctgctcatcatcatcttcctgacggtc
ctactactgaagctacgcaagcggcaccgcaagcacacacagcagcgggcggctgccctc
tcgctcagtaccctggccagtcccaaggggggcagtggcacagcgggcaccgagcccagc
gacatcatcattcccttacggactacagagaacaactactgcccccactatgagaaggtg
agtggggactacgggcaccctgtctacatcgtccaagagatgccgccccagagcccggcg
aacatctactacaaggtctga

DBGET integrated database retrieval system