KEGG   Homo sapiens (human): 1947Help
Entry
1947              CDS       T01001                                 

Gene name
EFNB1, CFND, CFNS, EFL3, EPLG2, Elk-L, LERK2
Definition
ephrin-B1
Orthology
K05463  
ephrin-B
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Disease
H00458  
Craniosynostosis
Class
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
Xq12
AA seq 346 aa AA seqDB search
MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKL
DIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPN
YMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSR
PSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVAL
FAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPS
DIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggctcggcctgggcagcgttggctcggcaagtggcttgtggcgatggtcgtgtgggcg
ctgtgccggctcgccacaccgctggccaagaacctggagcccgtatcctggagctccctc
aaccccaagttcctgagtgggaagggcttggtgatctatccgaaaattggagacaagctg
gacatcatctgcccccgagcagaagcagggcggccctatgagtactacaagctgtacctg
gtgcggcctgagcaggcagctgcctgtagcacagttctcgaccccaacgtgttggtcacc
tgcaataggccagagcaggaaatacgctttaccatcaagttccaggagttcagccccaac
tacatgggcctggagttcaagaagcaccatgattactacattacctcaacatccaatgga
agcctggaggggctggaaaaccgggagggcggtgtgtgccgcacacgcaccatgaagatc
atcatgaaggttgggcaagatcccaatgctgtgacgcctgagcagctgactaccagcagg
cccagcaaggaggcagacaacactgtcaagatggccacacaggcccctggtagtcggggc
tccctgggtgactctgatggcaagcatgagactgtgaaccaggaagagaagagtggccca
ggtgcaagtgggggcagcagcggggaccctgatggcttcttcaactccaaggtggcattg
ttcgcggctgtcggtgccggttgcgtcatcttcctgctcatcatcatcttcctgacggtc
ctactactgaagctacgcaagcggcaccgcaagcacacacagcagcgggcggctgccctc
tcgctcagtaccctggccagtcccaaggggggcagtggcacagcgggcaccgagcccagc
gacatcatcattcccttacggactacagagaacaactactgcccccactatgagaaggtg
agtggggactacgggcaccctgtctacatcgtccaagagatgccgccccagagcccggcg
aacatctactacaaggtctga

DBGET integrated database retrieval system