KEGG   Homo sapiens (human): 1947Help
Entry
1947              CDS       T01001                                 

Gene name
EFNB1, CFND, CFNS, EFB1, EFL3, EPLG2, Elk-L, LERK2
Definition
(RefSeq) ephrin B1
  KO
K05463  ephrin-B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Disease
H00458  Craniosynostosis
H01992  Craniofrontonasal syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    1947 (EFNB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   1947 (EFNB1)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1947 (EFNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin DUF4381 TMEM132D_C Syndecan Cadherin_C_2 Baculo_11_kDa
Motif
Other DBs
NCBI-GeneID: 1947
NCBI-ProteinID: NP_004420
OMIM: 300035
HGNC: 3226
Ensembl: ENSG00000090776
Vega: OTTHUMG00000021751
Pharos: P98172(Tbio)
UniProt: P98172
LinkDB All DBs
Position
Xq13.1
AA seq 346 aa AA seqDB search
MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKL
DIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPN
YMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSR
PSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVAL
FAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPS
DIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggctcggcctgggcagcgttggctcggcaagtggcttgtggcgatggtcgtgtgggcg
ctgtgccggctcgccacaccgctggccaagaacctggagcccgtatcctggagctccctc
aaccccaagttcctgagtgggaagggcttggtgatctatccgaaaattggagacaagctg
gacatcatctgcccccgagcagaagcagggcggccctatgagtactacaagctgtacctg
gtgcggcctgagcaggcagctgcctgtagcacagttctcgaccccaacgtgttggtcacc
tgcaataggccagagcaggaaatacgctttaccatcaagttccaggagttcagccccaac
tacatgggcctggagttcaagaagcaccatgattactacattacctcaacatccaatgga
agcctggaggggctggaaaaccgggagggcggtgtgtgccgcacacgcaccatgaagatc
atcatgaaggttgggcaagatcccaatgctgtgacgcctgagcagctgactaccagcagg
cccagcaaggaggcagacaacactgtcaagatggccacacaggcccctggtagtcggggc
tccctgggtgactctgatggcaagcatgagactgtgaaccaggaagagaagagtggccca
ggtgcaagtgggggcagcagcggggaccctgatggcttcttcaactccaaggtggcattg
ttcgcggctgtcggtgccggttgcgtcatcttcctgctcatcatcatcttcctgacggtc
ctactactgaagctacgcaagcggcaccgcaagcacacacagcagcgggcggctgccctc
tcgctcagtaccctggccagtcccaaggggggcagtggcacagcgggcaccgagcccagc
gacatcatcattcccttacggactacagagaacaactactgcccccactatgagaaggtg
agtggggactacgggcaccctgtctacatcgtccaagagatgccgccccagagcccggcg
aacatctactacaaggtctga

DBGET integrated database retrieval system