KEGG   Homo sapiens (human): 201163Help
Entry
201163            CDS       T01001                                 

Gene name
FLCN, BHD, FLCL
Definition
(RefSeq) folliculin
  KO
K09594  folliculin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa05211  Renal cell carcinoma
Disease
H00021  Renal cell carcinoma
H00818  Birt-Hogg-Dube syndrome
H01110  Pneumothorax
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    201163 (FLCN)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    201163 (FLCN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Folliculin_C Folliculin
Motif
Other DBs
NCBI-GeneID: 201163
NCBI-ProteinID: NP_659434
OMIM: 607273
HGNC: 27310
Ensembl: ENSG00000154803
Vega: OTTHUMG00000059275
Pharos: Q8NFG4(Tbio)
UniProt: Q8NFG4
LinkDB All DBs
Structure
PDB: 

Jmol
Position
17p11.2
AA seq 579 aa AA seqDB search
MNAIVALCHFCELHGPRTLFCTEVLHAPLPQGDGNEDSPGQGEQAEEEEGGIQMNSRMRA
HSPAEGASVESSSPGPKKSDMCEGCRSLAAGHPGYISHDKETSIKYVSHQHPSHPQLFSI
VRQACVRSLSCEVCPGREGPIFFGDEQHGFVFSHTFFIKDSLARGFQRWYSIITIMMDRI
YLINSWPFLLGKVRGIIDELQGKALKVFEAEQFGCPQRAQRMNTAFTPFLHQRNGNAARS
LTSLTSDDNLWACLHTSFAWLLKACGSRLTEKLLEGAPTEDTLVQMEKLADLEEESESWD
NSEAEEEEKAPVLPESTEGRELTQGPAESSSLSGCGSWQPRKLPVFKSLRHMRQVLGAPS
FRMLAWHVLMGNQVIWKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGL
SPHVQIPPHVLSSEFAVIVEVHAAARSTLHPVGCEDDQSLSKYEFVVTSGSPVAADRVGP
TILNKIEAALTNQNLSVDVVDQCLVCLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILG
ASEEDNVKLLKFWMTGLSKTYKSHLMSTVRSPTASESRN
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccatcgtggctctctgccacttctgcgagctccacggcccccgcactctcttc
tgcacggaggtgctgcacgccccacttcctcaaggggatgggaatgaggacagtcctggc
cagggtgagcaggcggaagaagaggaaggtggcattcagatgaacagtcggatgcgtgcg
cacagccccgcagagggggccagcgtcgagtccagcagcccggggcccaaaaagtcggac
atgtgcgagggctgccggtcacttgctgcagggcacccgggatatatcagccatgataaa
gagacctccattaaatacgtcagccaccagcaccccagccacccccagctcttcagcatt
gtccgccaggcctgtgtccggagcctgagctgtgaggtctgccctggccgtgaaggcccc
atcttcttcggagatgagcagcacggctttgtgttcagccacaccttcttcatcaaggac
agcctggccaggggcttccagcgctggtacagcatcatcaccatcatgatggaccggatc
tacctcatcaactcctggcccttcctgctggggaaggtccggggaatcatcgatgagctc
cagggcaaggcgctcaaggtgtttgaggcagagcagtttggatgcccacagcgtgctcag
aggatgaacacagccttcacgccattcctacaccagaggaacggcaacgccgcccgctcg
ctgacatcgctgacaagtgatgacaacctgtgggcgtgcctgcacacctcctttgcctgg
ctcctgaaggcgtgtggcagccggctgaccgagaagctcctggaaggtgctccgaccgag
gataccttggtccagatggagaagctcgctgatttagaagaggaatcagaaagctgggac
aactctgaggctgaagaggaggagaaagcccctgtgttgccagagagtacagaagggcgg
gagctgacccagggcccggcagagtcctcctctctctcaggctgtgggagctggcagccc
cggaagctgccagtcttcaagtccctccggcacatgaggcaggtcctgggtgccccttct
ttccgcatgctggcctggcacgttctcatggggaaccaggtgatctggaaaagcagagac
gtggacctcgtccagtcagcttttgaagtacttcggaccatgcttcccgtgggctgcgtc
cgcatcatcccatacagcagccagtacgaggaggcctatcggtgcaacttcctggggctc
agcccgcacgtgcagatccccccccacgtgctctcctcagagtttgctgtcatcgtggag
gtccacgcagccgcacgttccaccctccaccctgtggggtgtgaggatgaccagtctctc
agcaagtacgagtttgtggtgaccagtgggagccctgtagctgcagaccgagtgggcccc
accatcctgaataagattgaagcggctctgaccaaccagaacctgtctgtggatgtggtg
gaccagtgcctcgtctgcctcaaggaggagtggatgaacaaagtgaaggtgctttttaag
ttcaccaaggtggacagtcgacccaaagaggacacacagaagctgctgagcatcctgggt
gcgtccgaggaggacaatgtcaagctgctgaagttctggatgactggcctgagcaagacc
tacaagtcacacctcatgtccacggtccgcagccccacagcctcggagtctcggaactga

DBGET integrated database retrieval system