KEGG   Homo sapiens (human): 201163Help
Entry
201163            CDS       T01001                                 

Gene name
FLCN, BHD, FLCL
Definition
folliculin
Orthology
K09594  
folliculin
Organism
hsa  Homo sapiens (human)
Pathway
Renal cell carcinoma
Disease
H00021  
Renal cell carcinoma
H00818  
Birt-Hogg-Dube syndrome
H01110  
Pneumothorax
Class
Human Diseases; Cancers; Renal cell carcinoma [PATH:hsa05211]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
17p11.2
AA seq 342 aa AA seqDB search
MNAIVALCHFCELHGPRTLFCTEVLHAPLPQGDGNEDSPGQGEQAEEEEGGIQMNSRMRA
HSPAEGASVESSSPGPKKSDMCEGCRSLAAGHPGYISHDKETSIKYVSHQHPSHPQLFSI
VRQACVRSLSCEVCPGREGPIFFGDEQHGFVFSHTFFIKDSLARGFQRWYSIITIMMDRI
YLINSWPFLLGKVRGIIDELQGKALKVFEAEQFGCPQRAQRMNTAFTPFLHQRNGNAARS
LTSLTSDDNLWACLHTSFAWLLKACGSRLTEKLLEGAPTEDTLVQMEKLAGEAGVLLPGP
WPGWPWGGTSCLLSWQESLREGNAALNQPRTSLREAHPPISV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccatcgtggctctctgccacttctgcgagctccacggcccccgcactctcttc
tgcacggaggtgctgcacgccccacttcctcaaggggatgggaatgaggacagtcctggc
cagggtgagcaggcggaagaagaggaaggtggcattcagatgaacagtcggatgcgtgcg
cacagccccgcagagggggccagcgtcgagtccagcagcccggggcccaaaaagtcggac
atgtgcgagggctgccggtcacttgctgcagggcacccgggatatatcagccatgataaa
gagacctccattaaatacgtcagccaccagcaccccagccacccccagctcttcagcatt
gtccgccaggcctgtgtccggagcctgagctgtgaggtctgccctggccgtgaaggcccc
atcttcttcggagatgagcagcacggctttgtgttcagccacaccttcttcatcaaggac
agcctggccaggggcttccagcgctggtacagcatcatcaccatcatgatggaccggatc
tacctcatcaactcctggcccttcctgctggggaaggtccggggaatcatcgatgagctc
cagggcaaggcgctcaaggtgtttgaggcagagcagtttggatgcccacagcgtgctcag
aggatgaacacagccttcacgccattcctacaccagaggaacggcaacgccgcccgctcg
ctgacatcgctgacaagtgatgacaacctgtgggcgtgcctgcacacctcctttgcctgg
ctcctgaaggcgtgtggcagccggctgaccgagaagctcctggaaggtgctccgaccgag
gataccttggtccagatggagaagctcgctggtgaggcaggggtgctgttgccggggcct
tggcccggatggccgtggggcggtaccagctgtctgctctcctggcaggaatcgctgagg
gagggaaacgcggctctgaatcagcccagaacgagccttcgggaagctcaccctccgatc
tcggtgtga

DBGET integrated database retrieval system