KEGG   Homo sapiens (human): 2056Help
Entry
2056              CDS       T01001                                 

Gene name
EPO, EP, MVCD2
Definition
erythropoietin
Orthology
K05437  
erythropoietin
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Hematopoietic cell lineage
Disease
H01360  
Allergic rhinitis
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
7q22
AA seq 193 aa AA seqDB search
MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHC
SLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQL
HVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKL
KLYTGEACRTGDR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgcacgaatgtcctgcctggctgtggcttctcctgtccctgctgtcgctccct
ctgggcctcccagtcctgggcgccccaccacgcctcatctgtgacagccgagtcctggag
aggtacctcttggaggccaaggaggccgagaatatcacgacgggctgtgctgaacactgc
agcttgaatgagaatatcactgtcccagacaccaaagttaatttctatgcctggaagagg
atggaggtcgggcagcaggccgtagaagtctggcagggcctggccctgctgtcggaagct
gtcctgcggggccaggccctgttggtcaactcttcccagccgtgggagcccctgcagctg
catgtggataaagccgtcagtggccttcgcagcctcaccactctgcttcgggctctggga
gcccagaaggaagccatctcccctccagatgcggcctcagctgctccactccgaacaatc
actgctgacactttccgcaaactcttccgagtctactccaatttcctccggggaaagctg
aagctgtacacaggggaggcctgcaggacaggggacagatga

DBGET integrated database retrieval system