KEGG   Homo sapiens (human): 2057Help
Entry
2057              CDS       T01001                                 

Gene name
EPOR, EPO-R
Definition
erythropoietin receptor
Orthology
K05079  
erythropoietin receptor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Hematopoietic cell lineage
Disease
H00236  
Congenital polycythemia
Drug target
Erythropoietin: 
Darbepoetin alfa: 
Peginesatide: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    2057 (EPOR)
   04151 PI3K-Akt signaling pathway
    2057 (EPOR)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2057 (EPOR)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    2057 (EPOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
19p13.3-p13.2
AA seq 508 aa AA seqDB search
MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDL
VCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPL
ELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRY
EVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPV
SLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTH
KGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVG
SEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGAS
AASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGL
SDGPYSNPYENSLIPAAEPLPPSYVACS
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggaccacctcggggcgtccctctggccccaggtcggctccctttgtctcctgctcgct
ggggccgcctgggcgcccccgcctaacctcccggaccccaagttcgagagcaaagcggcc
ttgctggcggcccgggggcccgaagagcttctgtgcttcaccgagcggttggaggacttg
gtgtgtttctgggaggaagcggcgagcgctggggtgggcccgggcaactacagcttctcc
taccagctcgaggatgagccatggaagctgtgtcgcctgcaccaggctcccacggctcgt
ggtgcggtgcgcttctggtgttcgctgcctacagccgacacgtcgagcttcgtgccccta
gagttgcgcgtcacagcagcctccggcgctccgcgatatcaccgtgtcatccacatcaat
gaagtagtgctcctagacgcccccgtggggctggtggcgcggttggctgacgagagcggc
cacgtagtgttgcgctggctcccgccgcctgagacacccatgacgtctcacatccgctac
gaggtggacgtctcggccggcaacggcgcagggagcgtacagagggtggagatcctggag
ggccgcaccgagtgtgtgctgagcaacctgcggggccggacgcgctacaccttcgccgtc
cgcgcgcgtatggctgagccgagcttcggcggcttctggagcgcctggtcggagcctgtg
tcgctgctgacgcctagcgacctggaccccctcatcctgacgctctccctcatcctcgtg
gtcatcctggtgctgctgaccgtgctcgcgctgctctcccaccgccgggctctgaagcag
aagatctggcctggcatcccgagcccagagagcgagtttgaaggcctcttcaccacccac
aagggtaacttccagctgtggctgtaccagaatgatggctgcctgtggtggagcccctgc
acccccttcacggaggacccacctgcttccctggaagtcctctcagagcgctgctggggg
acgatgcaggcagtggagccggggacagatgatgagggccccctgctggagccagtgggc
agtgagcatgcccaggatacctatctggtgctggacaaatggttgctgccccggaacccg
cccagtgaggacctcccagggcctggtggcagtgtggacatagtggccatggatgaaggc
tcagaagcatcctcctgctcatctgctttggcctcgaagcccagcccagagggagcctct
gctgccagctttgagtacactatcctggaccccagctcccagctcttgcgtccatggaca
ctgtgccctgagctgccccctaccccaccccacctaaagtacctgtaccttgtggtatct
gactctggcatctcaactgactacagctcaggggactcccagggagcccaagggggctta
tccgatggcccctactccaacccttatgagaacagccttatcccagccgctgagcctctg
ccccccagctatgtggcttgctcttag

DBGET integrated database retrieval system