KEGG   Homo sapiens (human): 2071Help
Entry
2071              CDS       T01001                                 

Gene name
ERCC3, BTF2, GTF2H, RAD25, TFIIH, XPB
Definition
excision repair cross-complementing rodent repair deficiency, complementation group 3 (EC:3.6.4.12)
Orthology
K10843  
DNA excision repair protein ERCC-3 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Disease
H00403  
Disorders of nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:hsa03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:hsa03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2q21
AA seq 782 aa AA seqDB search
MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKD
YRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTA
YSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESC
HPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQG
KSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRND
SVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKR
CLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRS
WEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDL
NFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNK
FRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNP
KINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFY
SLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAAT
DLDAEEEVVAGEFGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPSKHVHPLFKRF
RK
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaagagaccgagcggaccgcgacaagaagaaatccaggaagcggcactatgag
gatgaagaggatgatgaagaggacgccccggggaacgaccctcaggaagcggttccctcg
gcggcggggaagcaggtggatgagtcaggcaccaaagtggatgaatatggagccaaggac
tacaggctgcaaatgccgctgaaggacgaccacacctccaggcccctctgggtggctccc
gatggccatatcttcttggaagccttctctccagtttacaaatatgcccaagacttcttg
gtggctattgcagagccagtgtgccgaccaacccatgtgcatgagtacaaactaactgcc
tactccttgtatgcagctgtcagcgttgggctgcaaaccagtgacatcaccgagtacctc
aggaagctcagcaagactggagtccctgatggaattatgcagtttattaagttgtgtact
gtcagctatggaaaagtcaagctggtcttgaagcacaacagatacttcgttgaaagttgc
caccctgatgtaatccagcatcttctccaggaccccgtgatccgagaatgccgcttaaga
aactctgaaggggaggccactgagctcatcacagagactttcacaagcaaatctgccatt
tctaagactgctgaaagcagtggtgggccctccacttcccgagtgacagatccacagggt
aaatctgacatccccatggacctgtttgacttctatgagcaaatggacaaggatgaagaa
gaagaagaagagacacagacagtgtcttttgaagtcaagcaggaaatgattgaggaactc
cagaaacgttgcatccacctggagtaccctctgttggcagaatatgacttccggaatgat
tctgtcaaccctgatatcaacattgacctaaagcccacagctgtcctcagaccctatcag
gagaagagcttgcgaaagatgtttggaaacgggcgtgcacgttcgggggtcattgttctt
ccctgcggtgctggaaagtccctggttggtgtgactgctgcatgcactgtcagaaaacgc
tgtctggtgctgggcaactcagctgtttctgtggagcagtggaaagcccagttcaagatg
tggtccaccattgacgacagccagatctgccggttcacctccgatgccaaggacaagccc
atcggctgctccgttgccattagcacctactccatgctgggccacaccaccaaaaggtcc
tgggaggccgagcgagtcatggagtggctcaagacccaggagtggggcctcatgatcctg
gatgaagtgcacaccataccagccaagatgttccgaagggtgctcaccatcgtgcaggcc
cactgtaagctgggtttgactgcgaccctcgtccgcgaagatgacaaaattgtggattta
aattttctgattgggcctaagctctacgaagccaactggatggagctgcagaataatggc
tacatcgccaaagtccagtgtgctgaggtctggtgccctatgtctcctgaattttaccgg
gaatatgtggcaatcaaaaccaagaaacgaatcttgctgtacaccatgaaccccaacaaa
tttagagcttgccagtttctgatcaagtttcatgaaaggaggaatgacaagattattgtc
tttgctgacaatgtgtttgccctaaaggaatatgccattcgactgaacaaaccctatatc
tacggacctacgtctcagggggaaaggatgcaaattctccagaatttcaagcacaacccc
aaaattaacaccatcttcatatccaaggtaggtgacacttcgtttgatctgccggaagca
aatgtcctcattcagatctcatcccatggtggctccaggcgtcaggaagcccaaaggcta
gggcgggtgcttcgagctaaaaaagggatggttgcagaagagtacaatgcctttttctac
tcactggtatcccaggacacacaggaaatggcttactcaaccaagcggcagagattcttg
gtagatcaaggttatagcttcaaggtgatcacgaaactcgctggcatggaggaggaagac
ttggcgttttcgacaaaagaagagcaacagcagctcttacagaaagtcctggcagccact
gacctggatgccgaggaggaggtggtggctggggaatttggctccagatccagccaggca
tctcggcgctttggcaccatgagttctatgtctggggccgacgacactgtgtacatggag
taccactcatcgcggagcaaggcgcccagcaaacatgtacacccgctcttcaagcgcttt
aggaaatga

DBGET integrated database retrieval system