KEGG   Homo sapiens (human): 2071Help
Entry
2071              CDS       T01001                                 

Gene name
ERCC3, BTF2, GTF2H, RAD25, TFIIH, XPB
Definition
excision repair cross-complementation group 3 (EC:3.6.4.12)
Orthology
K10843  
DNA excision repair protein ERCC-3 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Disease
H00403  
Disorders of nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    2071 (ERCC3)
  Replication and repair
   03420 Nucleotide excision repair
    2071 (ERCC3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     2071 (ERCC3)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     2071 (ERCC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2q21
AA seq 782 aa AA seqDB search
MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKD
YRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTA
YSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESC
HPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQG
KSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRND
SVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKR
CLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRS
WEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDL
NFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNK
FRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNP
KINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFY
SLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAAT
DLDAEEEVVAGEFGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPSKHVHPLFKRF
RK
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaagagaccgagcggaccgcgacaagaagaaatccaggaagcggcactatgag
gatgaagaggatgatgaagaggacgccccggggaacgaccctcaggaagcggttccctcg
gcggcggggaagcaggtggatgagtcaggcaccaaagtggatgaatatggagccaaggac
tacaggctgcaaatgccgctgaaggacgaccacacctccaggcccctctgggtggctccc
gatggccatatcttcttggaagccttctctccagtttacaaatatgcccaagacttcttg
gtggctattgcagagccagtgtgccgaccaacccatgtgcatgagtacaaactaactgcc
tactccttgtatgcagctgtcagcgttgggctgcaaaccagtgacatcaccgagtacctc
aggaagctcagcaagactggagtccctgatggaattatgcagtttattaagttgtgtact
gtcagctatggaaaagtcaagctggtcttgaagcacaacagatacttcgttgaaagttgc
caccctgatgtaatccagcatcttctccaggaccccgtgatccgagaatgccgcttaaga
aactctgaaggggaggccactgagctcatcacagagactttcacaagcaaatctgccatt
tctaagactgctgaaagcagtggtgggccctccacttcccgagtgacagatccacagggt
aaatctgacatccccatggacctgtttgacttctatgagcaaatggacaaggatgaagaa
gaagaagaagagacacagacagtgtcttttgaagtcaagcaggaaatgattgaggaactc
cagaaacgttgcatccacctggagtaccctctgttggcagaatatgacttccggaatgat
tctgtcaaccctgatatcaacattgacctaaagcccacagctgtcctcagaccctatcag
gagaagagcttgcgaaagatgtttggaaacgggcgtgcacgttcgggggtcattgttctt
ccctgcggtgctggaaagtccctggttggtgtgactgctgcatgcactgtcagaaaacgc
tgtctggtgctgggcaactcagctgtttctgtggagcagtggaaagcccagttcaagatg
tggtccaccattgacgacagccagatctgccggttcacctccgatgccaaggacaagccc
atcggctgctccgttgccattagcacctactccatgctgggccacaccaccaaaaggtcc
tgggaggccgagcgagtcatggagtggctcaagacccaggagtggggcctcatgatcctg
gatgaagtgcacaccataccagccaagatgttccgaagggtgctcaccatcgtgcaggcc
cactgtaagctgggtttgactgcgaccctcgtccgcgaagatgacaaaattgtggattta
aattttctgattgggcctaagctctacgaagccaactggatggagctgcagaataatggc
tacatcgccaaagtccagtgtgctgaggtctggtgccctatgtctcctgaattttaccgg
gaatatgtggcaatcaaaaccaagaaacgaatcttgctgtacaccatgaaccccaacaaa
tttagagcttgccagtttctgatcaagtttcatgaaaggaggaatgacaagattattgtc
tttgctgacaatgtgtttgccctaaaggaatatgccattcgactgaacaaaccctatatc
tacggacctacgtctcagggggaaaggatgcaaattctccagaatttcaagcacaacccc
aaaattaacaccatcttcatatccaaggtaggtgacacttcgtttgatctgccggaagca
aatgtcctcattcagatctcatcccatggtggctccaggcgtcaggaagcccaaaggcta
gggcgggtgcttcgagctaaaaaagggatggttgcagaagagtacaatgcctttttctac
tcactggtatcccaggacacacaggaaatggcttactcaaccaagcggcagagattcttg
gtagatcaaggttatagcttcaaggtgatcacgaaactcgctggcatggaggaggaagac
ttggcgttttcgacaaaagaagagcaacagcagctcttacagaaagtcctggcagccact
gacctggatgccgaggaggaggtggtggctggggaatttggctccagatccagccaggca
tctcggcgctttggcaccatgagttctatgtctggggccgacgacactgtgtacatggag
taccactcatcgcggagcaaggcgcccagcaaacatgtacacccgctcttcaagcgcttt
aggaaatga

DBGET integrated database retrieval system