KEGG   Homo sapiens (human): 2073Help
Entry
2073              CDS       T01001                                 

Gene name
ERCC5, COFS3, ERCM2, UVDR, XPG, XPGC
Definition
excision repair cross-complementation group 5
Orthology
K10846  
DNA excision repair protein ERCC-5
Organism
hsa  Homo sapiens (human)
Pathway
Nucleotide excision repair
Disease
H00403  
Disorders of nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    2073 (ERCC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
13q33
AA seq 1186 aa AA seqDB search
MGVQGLWKLLECSGRQVSPEALEGKILAVDISIWLNQALKGVRDRHGNSIENPHLLTLFH
RLCKLLFFRIRPIFVFDGDAPLLKKQTLVKRRQRKDLASSDSRKTTEKLLKTFLKRQAIK
TAFRSKRDEALPSLTQVRRENDLYVLPPLQEEEKHSSEEEDEKEWQERMNQKQALQEEFF
HNPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQYQLKGLLKK
NYLNQHIEHVQKEMNQQHSGHIRRQYEDEGGFLKEVESRRVVSEDTSHYILIKGIQAKTV
AEVDSESLPSSSKMHGMSFDVKSSPCEKLKTEKEPDATPPSPRTLLAMQAALLGSSSEEE
LESENRRQARGRNAPAAVDEGSISPRTLSAIKRALDDDEDVKVCAGDDVQTGGPGAEEMR
INSSTENSDEGLKVRDGKGIPFTATLASSSVNSAEEHVASTNEGREPTDSVPKEQMSLVH
VGTEAFPISDESMIKDRKDRLPLESAVVRHSDAPGLPNGRELTPASPTCTNSVSKNETHA
EVLEQQNELCPYESKFDSSLLSSDDETKCKPNSASEVIGPVSLQETSSIVSVPSEAVDNV
ENVVSFNAKEHENFLETIQEQQTTESAGQDLISIPKAVEPMEIDSEESESDGSFIEVQSV
ISDEELQAEFPETSKPPSEQGEEELVGTREGEAPAESESLLRDNSERDDVDGEPQEAEKD
AEDSLHEWQDINLEELETLESNLLAQQNSLKAQKQQQERIAATVTGQMFLESQELLRLFG
IPYIQAPMEAEAQCAILDLTDQTSGTITDDSDIWLFGARHVYRNFFNKNKFVEYYQYVDF
HNQLGLDRNKLINLAYLLGSDYTEGIPTVGCVTAMEILNEFPGHGLEPLLKFSEWWHEAQ
KNPKIRPNPHDTKVKKKLRTLQLTPGFPNPAVAEAYLKPVVDDSKGSFLWGKPDLDKIRE
FCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVT
CMLRKEKEAAASEIEAVSVAMEKEFELLDKAKRKTQKRGITNTLEESSSLKRKRLSDSKR
KNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKN
GGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT
NT seq 3561 nt NT seq  +upstreamnt  +downstreamnt
atgggggtccaggggctctggaagctgctggagtgctccgggcggcaggtcagccccgaa
gcgctggaagggaagatcctggctgttgatattagcatttggttaaaccaagcacttaaa
ggagtccgggatcgccatgggaactcaatagaaaatcctcatcttctcactttgtttcat
cggctctgcaaactcttattttttcgaattcgtcctatttttgtgtttgatggggatgct
ccactattgaagaaacagactttggtgaagagaaggcagagaaaggacttagcgtccagt
gactccaggaaaacgacagagaagcttctgaaaacatttttgaaaagacaagccatcaaa
actgccttcagaagcaaaagagatgaagcactacccagtcttacccaagttcgaagagaa
aacgacctctatgttttgcctcctttacaagaggaagaaaaacacagttcagaagaggaa
gatgaaaaagaatggcaagaaagaatgaatcaaaaacaagcattacaggaagagttcttt
cataatcctcaagcgatagatattgagtctgaggacttcagcagcctgccccctgaagta
aagcatgaaatcttgactgatatgaaagagttcaccaagcgcagaagaacattatttgaa
gcaatgccagaggagtctgatgacttttcacagtaccaactcaaaggcttgcttaaaaag
aactatctgaaccagcatatagaacatgtccaaaaggaaatgaatcagcaacattcagga
cacatccgaaggcagtatgaagatgaagggggctttctgaaggaggtagagtcaaggaga
gtggtctctgaagacacttcacattacatcttgataaaaggtattcaagctaagacagtt
gcagaagtggattcagagtctcttccttcttccagcaaaatgcacggcatgtcttttgac
gtgaagtcatctccatgtgaaaaactgaagacagagaaagagcctgatgctacccctcct
tctccaagaactttactagctatgcaagctgccctgctgggaagtagctcagaagaggag
ctggagagtgaaaatcgaaggcaggcccgtgggaggaacgcacctgctgctgtagacgaa
ggctccatatcaccccggactctttcagccattaagagagctcttgacgatgacgaagat
gtaaaagtgtgtgctggggatgatgtgcagacgggagggccaggagcagaagaaatgcgt
ataaacagctccaccgagaacagtgatgaaggacttaaagtgagagatggaaaaggaata
ccgtttactgcaacacttgcgtcatctagtgtgaactctgcagaggagcacgtagccagc
actaatgaggggagagagcccacagactcagttccaaaagaacaaatgtcacttgttcac
gtggggactgaagcctttccgataagtgatgagtctatgattaaggacagaaaagatcgg
ctgcctctggagagtgcagtggttagacatagtgacgcacctgggctcccgaatggaagg
gaactgacaccggcatctccaacttgtacaaattctgtgtcaaagaatgaaacacatgct
gaagtgcttgagcagcagaacgaactttgcccatatgagagtaaattcgattcttctctt
ctttcaagtgatgatgaaacaaaatgtaaaccgaattctgcttctgaagtcattggccct
gtcagtttgcaagaaacaagtagcatagtaagtgtcccttcagaggcagtagataatgtg
gaaaatgtggtgtcatttaatgctaaagagcatgagaattttctggaaaccatccaagaa
cagcagaccactgaatctgcaggccaggatttaatttccattccaaaggccgtggaacca
atggaaattgactcggaagaaagtgaatctgatggaagtttcattgaagtgcaaagtgtg
attagtgatgaggaacttcaagcagaattccctgaaacttccaaacctccctcagaacaa
ggcgaagaggaactggtaggaactagggagggagaagcccctgctgagtccgagagcctc
ctgagggacaactctgagagggacgacgtggatggtgagccacaggaagctgagaaagat
gcggaagattcgctccatgaatggcaagatattaatttggaggagttggaaactctggag
agcaacctcttagcacagcagaattcactgaaagctcaaaaacagcagcaagaacggatc
gctgctactgtcaccggacagatgttcctggaaagccaggaactcctgcgcctgttcggc
attccctacatccaggctcccatggaagcagaggcgcagtgcgccatcctggacctgact
gatcagacttccggaaccatcactgatgacagtgatatctggctgtttggagcgcggcat
gtctatagaaacttttttaataaaaacaagtttgtagaatattatcaatatgtggacttt
cacaatcaattgggattggaccggaataagttaataaatttggcttatttgcttggaagt
gattataccgaaggaataccaactgtgggttgtgtaaccgccatggaaattctcaatgaa
ttccctgggcatggcctggaacctctcctaaaattctcagaatggtggcatgaagctcaa
aaaaatccaaagataagacctaatcctcatgacaccaaagtgaaaaaaaaattacggaca
ttgcaactcacccctggctttcctaacccagctgttgccgaggcctacctcaaacccgtg
gtggatgactcgaagggatcctttctgtgggggaaacctgatctcgacaaaattagagaa
ttttgtcagcggtatttcggctggaacagaacgaagacagatgaatctctgtttcctgta
ttaaagcaactcgatgcccagcagacacagctccgaattgattccttctttagattagca
caacaggagaaagaagatgctaaacgtattaagagccagagactaaacagagctgtgaca
tgtatgctaaggaaagagaaagaagcagcagccagcgaaatagaagcagtttctgttgcc
atggagaaagaatttgagctacttgataaggcaaaacgaaaaacccagaagagaggcata
acaaataccttagaagagtcatcaagcctgaaaagaaagaggctttcagattctaaacga
aagaatacatgcggtggatttttgggggagacctgcctctcagaatcatctgatggatct
tcaagtgaagatgctgaaagttcatctttaatgaatgtacaaaggagaacagctgcgaaa
gagccaaaaaccagtgcttcagattcgcagaactcagtgaaggaagctcccgtgaagaat
ggaggtgcgaccaccagcagctctagtgatagtgatgacgatggagggaaagagaagatg
gtcctcgtgaccgccagatctgtgtttgggaagaaaagaaggaaactaagacgtgcgagg
ggaagaaaaaggaaaacctaa

DBGET integrated database retrieval system