KEGG   Homo sapiens (human): 2100Help
Entry
2100              CDS       T01001                                 

Gene name
ESR2, ER-BETA, ESR-BETA, ESRB, ESTRB, Erb, NR3A2
Definition
estrogen receptor 2 (ER beta)
Orthology
K08551  
estrogen receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
Estrogen signaling pathway
Prolactin signaling pathway
Drug target
Ethinylestradiol: 
Estradiol: 
Estriol: 
Estrone: 
Promestriene: 
Conjugated estrogens: 
Dienestrol: 
Diethylstilbestrol: 
Tibolone: 
Clomifene: 
Raloxifene: 
Bazedoxifene: 
Lasofoxifene: 
Ormeloxifen: 
Ospemifene: 
Polyestradiol phosphate: 
Tamoxifen: 
Toremifene: 
Fulvestrant: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    2100 (ESR2)
   04917 Prolactin signaling pathway
    2100 (ESR2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    2100 (ESR2)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3A. Estrogen receptor
   2100 (ESR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
14q23.2
AA seq 495 aa AA seqDB search
MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPS
NVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVN
RETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH
NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH
CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK
LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL
VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA
DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHARAEKASQTLTSF
GMKMETLLPEATMEQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggatataaaaaactcaccatctagccttaattctccttcctcctacaactgcagtcaa
tccatcttacccctggagcacggctccatatacataccttcctcctatgtagacagccac
catgaatatccagccatgacattctatagccctgctgtgatgaattacagcattcccagc
aatgtcactaacttggaaggtgggcctggtcggcagaccacaagcccaaatgtgttgtgg
ccaacacctgggcacctttctcctttagtggtccatcgccagttatcacatctgtatgcg
gaacctcaaaagagtccctggtgtgaagcaagatcgctagaacacaccttacctgtaaac
agagagacactgaaaaggaaggttagtgggaaccgttgcgccagccctgttactggtcca
ggttcaaagagggatgctcacttctgcgctgtctgcagcgattacgcatcgggatatcac
tatggagtctggtcgtgtgaaggatgtaaggccttttttaaaagaagcattcaaggacat
aatgattatatttgtccagctacaaatcagtgtacaatcgataaaaaccggcgcaagagc
tgccaggcctgccgacttcggaagtgttacgaagtgggaatggtgaagtgtggctcccgg
agagagagatgtgggtaccgccttgtgcggagacagagaagtgccgacgagcagctgcac
tgtgccggcaaggccaagagaagtggcggccacgcgccccgagtgcgggagctgctgctg
gacgccctgagccccgagcagctagtgctcaccctcctggaggctgagccgccccatgtg
ctgatcagccgccccagtgcgcccttcaccgaggcctccatgatgatgtccctgaccaag
ttggccgacaaggagttggtacacatgatcagctgggccaagaagattcccggctttgtg
gagctcagcctgttcgaccaagtgcggctcttggagagctgttggatggaggtgttaatg
atggggctgatgtggcgctcaattgaccaccccggcaagctcatctttgctccagatctt
gttctggacagggatgaggggaaatgcgtagaaggaattctggaaatctttgacatgctc
ctggcaactacttcaaggtttcgagagttaaaactccaacacaaagaatatctctgtgtc
aaggccatgatcctgctcaattccagtatgtaccctctggtcacagcgacccaggatgct
gacagcagccggaagctggctcacttgctgaacgccgtgaccgatgctttggtttgggtg
attgccaagagcggcatctcctcccagcagcaatccatgcgcctggctaacctcctgatg
ctcctgtcccacgtcaggcatgcgagggcagaaaaggcctctcaaacactcacctcattt
ggaatgaagatggagactcttttgcctgaagcaacgatggagcagtga

DBGET integrated database retrieval system