KEGG   Homo sapiens (human): 2120Help
Entry
2120              CDS       T01001                                 

Gene name
ETV6, TEL, TEL/ABL
Definition
ets variant 6
Orthology
K03211  
ETS translocation variant 6/7
Organism
hsa  Homo sapiens (human)
Pathway
Dorso-ventral axis formation
Transcriptional misregulation in cancer
Disease
H00001  
Acute lymphoblastic leukemia (ALL) (precursor B lymphoblastic leukemia)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    2120 (ETV6)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    2120 (ETV6)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2120 (ETV6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
12p13
AA seq 452 aa AA seqDB search
MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIY
WSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHI
LKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLH
RSRSPITTNHRPSPDPEQRPLRSPLDNMIRRLSPAERAQGPRPHQENNHQESYPLSVSPM
ENNHCPASSESHPKPSSPRQESTRVIQLMPSPIMHPLILNPRHSVDFKQSRLSEDGLHRE
GKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIADCRLLWDYVYQLLSDSRYENFIRW
EDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFM
KTPDEIMSGRTDRLEHLESQELDEQIYQEDEC
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagactcctgctcagtgtagcattaagcaggaacgaatttcatatacacctcca
gagagcccagtgccgagttacgcttcctcgacgccacttcatgttccagtgcctcgagcg
ctcaggatggaggaagactcgatccgcctgcctgcgcacctgcgcttgcagccaatttac
tggagcagggatgacgtagcccagtggctcaagtgggctgaaaatgagttttctttaagg
ccaattgacagcaacacgtttgaaatgaatggcaaagctctcctgctgctgaccaaagag
gactttcgctatcgatctcctcattcaggtgatgtgctctatgaactccttcagcatatt
ctgaagcagaggaaacctcggattcttttttcaccattcttccaccctggaaactctata
cacacacagccggaggtcatactgcatcagaaccatgaagaagataactgtgtccagagg
acccccaggccatccgtggataatgtgcaccataaccctcccaccattgaactgttgcac
cgctccaggtcacctatcacgacaaatcaccggccttctcctgaccccgagcagcggccc
ctccggtcccccctggacaacatgatccgccgcctctccccggctgagagagctcaggga
cccaggccgcaccaggagaacaaccaccaggagtcctaccctctgtcagtgtctcccatg
gagaataatcactgcccagcgtcctccgagtcccacccgaagccatccagcccccggcag
gagagcacacgcgtgatccagctgatgcccagccccatcatgcaccctctgatcctgaac
ccccggcactccgtggatttcaaacagtccaggctctccgaggacgggctgcatagggaa
gggaagcccatcaacctctctcatcgggaagacctggcttacatgaaccacatcatggtc
tctgtctccccgcctgaagagcacgccatgcccattgggagaatagcagactgtagactg
ctttgggattacgtctatcagttgctttctgacagccggtacgaaaacttcatccgatgg
gaggacaaagaatccaaaatattccggatagtggatcccaacggactggctcgactgtgg
ggaaaccataagaacagaacaaacatgacctatgagaaaatgtccagagccctgcgccac
tactacaaactaaacattatcaggaaggagccaggacaaaggcttttgttcaggtttatg
aaaaccccagatgaaatcatgagtggccgaacagaccgtctggagcacctagagtcccag
gagctggatgaacaaatataccaagaagatgaatgctga

DBGET integrated database retrieval system