KEGG   Homo sapiens (human): 2130Help
Entry
2130              CDS       T01001                                 

Gene name
EWSR1, EWS, EWS-FLI1, bK984G1.4
Definition
(RefSeq) EWS RNA binding protein 1
  KO
K13209  
RNA-binding protein EWS
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Disease
H00035  
Ewing's sarcoma
H00049  
Myxoid liposarcoma
H00052  
Clear cell sarcoma of soft tissue
H00053  
Extraskeletal myxoid chondrosarcoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    2130 (EWSR1)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    2130 (EWSR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
22q12.2
AA seq 656 aa AA seqDB search
MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTAT
YGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGT
QPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYP
MQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSY
PPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNR
GRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDN
SAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDP
PTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGP
GGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTEC
NQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFR
GGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccacggattacagtacctatagccaagctgcagcgcagcagggctacagtgct
tacaccgcccagcccactcaaggatatgcacagaccacccaggcatatgggcaacaaagc
tatggaacctatggacagcccactgatgtcagctatacccaggctcagaccactgcaacc
tatgggcagaccgcctatgcaacttcttatggacagcctcccactggttatactactcca
actgccccccaggcatacagccagcctgtccaggggtatggcactggtgcttatgatacc
accactgctacagtcaccaccacccaggcctcctatgcagctcagtctgcatatggcact
cagcctgcttatccagcctatgggcagcagccagcagccactgcacctacaagaccgcag
gatggaaacaagcccactgagactagtcaacctcaatctagcacagggggttacaaccag
cccagcctaggatatggacagagtaactacagttatccccaggtacctgggagctacccc
atgcagccagtcactgcacctccatcctaccctcctaccagctattcctctacacagccg
actagttatgatcagagcagttactctcagcagaacacctatgggcaaccgagcagctat
ggacagcagagtagctatggtcaacaaagcagctatgggcagcagcctcccactagttac
ccaccccaaactggatcctacagccaagctccaagtcaatatagccaacagagcagcagc
tacgggcagcagagttcattccgacaggaccaccccagtagcatgggtgtttatgggcag
gagtctggaggattttccggaccaggagagaaccggagcatgagtggccctgataaccgg
ggcaggggaagagggggatttgatcgtggaggcatgagcagaggtgggcggggaggagga
cgcggtggaatgggcagcgctggagagcgaggtggcttcaataagcctggtggacccatg
gatgaaggaccagatcttgatctaggcccacctgtagatccagatgaagactctgacaac
agtgcaatttatgtacaaggattaaatgacagtgtgactctagatgatctggcagacttc
tttaagcagtgtggggttgttaagatgaacaagagaactgggcaacccatgatccacatc
tacctggacaaggaaacaggaaagcccaaaggcgatgccacagtgtcctatgaagaccca
cccactgccaaggctgccgtggaatggtttgatgggaaagattttcaagggagcaaactt
aaagtctcccttgctcggaagaagcctccaatgaacagtatgcggggtggtctgccaccc
cgtgagggcagaggcatgccaccaccactccgtggaggtccaggaggcccaggaggtcct
gggggacccatgggtcgcatgggaggccgtggaggagatagaggaggcttccctccaaga
ggaccccggggttcccgagggaacccctctggaggaggaaacgtccagcaccgagctgga
gactggcagtgtcccaatccgggttgtggaaaccagaacttcgcctggagaacagagtgc
aaccagtgtaaggccccaaagcctgaaggcttcctcccgccaccctttccgcccccgggt
ggtgatcgtggcagaggtggccctggtggcatgcggggaggaagaggtggcctcatggat
cgtggtggtcccggtggaatgttcagaggtggccgtggtggagacagaggtggcttccgt
ggtggccggggcatggaccgaggtggctttggtggaggaagacgaggtggccctgggggg
ccccctggacctttgatggaacagatgggaggaagaagaggaggacgtggaggacctgga
aaaatggataaaggcgagcaccgtcaggagcgcagagatcggccctactag

DBGET integrated database retrieval system