KEGG   Homo sapiens (human): 2243Help
Entry
2243              CDS       T01001                                 

Gene name
FGA, Fib2
Definition
fibrinogen alpha chain
Orthology
K03903  
fibrinogen alpha chain
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Platelet activation
Disease
H00222  
Afibrinogenemia
H00223  
Inherited thrombophilia
H00845  
Familial amyloidosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    2243 (FGA)
   04611 Platelet activation
    2243 (FGA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2243 (FGA)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  2243 (FGA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4q28
AA seq 866 aa AA seqDB search
MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDSDWPFCSDEDW
NYKCPSGCRMKGLIDEVNQDFTNRINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSA
NNRDNTYNRVSEDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSC
RGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLPSRDRQHLPLIKMKPVPDLVPGNFKSQ
LQKVPPEWKALTDMPQMRMELERPGGNEITRGGSTSYGTGSETESPRNPSSAGSWNSGSS
GPGSTGNRNPGSSGTGGTATWKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTW
NPGSSERGSAGHWTSESSVSGSTGQWHSESGSFRPDSPGSGNARPNNPDWGTFEEVSGNV
SPGTRREYHTEKLVTSKGDKELRTGKEKVTSGSTTTTRRSCSKTVTKTVIGPDGHKEVTK
EVVTSEDGSDCPEAMDLGTLSGIGTLDGFRHRHPDEAAFFDTASTGKTFPGFFSPMLGEF
VSETESRGSESGIFTNTKESSSHHPGIAEFPSRGKSSSYSKQFTSSTSYNRGDSTFESKS
YKMADEAGSEADHEGTHSTKRGHAKSRPVRDCDDVLQTHPSGTQSGIFNIKLPGSSKIFS
VYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQR
GSVLRVELEDWAGNEAYAEYHFRVGSEAEGYALQVSSYEGTAGDALIEGSVEEGAEYTSH
NNMQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPRNNSPYEIENG
VVWVSFRGADYSLRAVRMKIRPLVTQ
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgttttccatgaggatcgtctgcctggtcctaagtgtggtgggcacagcatggactgca
gatagtggtgaaggtgactttctagctgaaggaggaggcgtgcgtggcccaagggttgtg
gaaagacatcaatctgcctgcaaagattcagactggcccttctgctctgatgaagactgg
aactacaaatgcccttctggctgcaggatgaaagggttgattgatgaagtcaatcaagat
tttacaaacagaataaataagctcaaaaattcactatttgaatatcagaagaacaataag
gattctcattcgttgaccactaatataatggaaattttgagaggcgatttttcctcagcc
aataaccgtgataatacctacaaccgagtgtcagaggatctgagaagcagaattgaagtc
ctgaagcgcaaagtcatagaaaaagtacagcatatccagcttctgcagaaaaatgttaga
gctcagttggttgatatgaaacgactggaggtggacattgatattaagatccgatcttgt
cgagggtcatgcagtagggctttagctcgtgaagtagatctgaaggactatgaagatcag
cagaagcaacttgaacaggtcattgccaaagacttacttccctctagagataggcaacac
ttaccactgataaaaatgaaaccagttccagacttggttcccggaaattttaagagccag
cttcagaaggtacccccagagtggaaggcattaacagacatgccgcagatgagaatggag
ttagagagacctggtggaaatgagattactcgaggaggctccacctcttatggaaccgga
tcagagacggaaagccccaggaaccctagcagtgctggaagctggaactctgggagctct
ggacctggaagtactggaaaccgaaaccctgggagctctgggactggagggactgcaacc
tggaaacctgggagctctggacctggaagtactggaagctggaactctgggagctctgga
actggaagtactggaaaccaaaaccctgggagccctagacctggtagtaccggaacctgg
aatcctggcagctctgaacgcggaagtgctgggcactggacctctgagagctctgtatct
ggtagtactggacaatggcactctgaatctggaagttttaggccagatagcccaggctct
gggaacgcgaggcctaacaacccagactggggcacatttgaagaggtgtcaggaaatgta
agtccagggacaaggagagagtaccacacagaaaaactggtcacttctaaaggagataaa
gagctcaggactggtaaagagaaggtcacctctggtagcacaaccaccacgcgtcgttca
tgctctaaaaccgttactaagactgttattggtcctgatggtcacaaagaagttaccaaa
gaagtggtgacctccgaagatggttctgactgtcccgaggcaatggatttaggcacattg
tctggcataggtactctggatgggttccgccataggcaccctgatgaagctgccttcttc
gacactgcctcaactggaaaaacattcccaggtttcttctcacctatgttaggagagttt
gtcagtgagactgagtctaggggctcagaatctggcatcttcacaaatacaaaggaatcc
agttctcatcaccctgggatagctgaattcccttcccgtggtaaatcttcaagttacagc
aaacaatttactagtagcacgagttacaacagaggagactccacatttgaaagcaagagc
tataaaatggcagatgaggccggaagtgaagccgatcatgaaggaacacatagcaccaag
agaggccatgctaaatctcgccctgtcagagactgtgatgatgtcctccaaacacatcct
tcaggtacccaaagtggcattttcaatatcaagctaccgggatccagtaagattttttct
gtttattgcgatcaagagaccagtttgggaggatggcttttgatccagcaaagaatggat
ggatcactgaattttaaccggacctggcaagactacaagagaggtttcggcagcctgaat
gacgagggggaaggagaattctggctaggcaatgactacctccacttactaacccaaagg
ggctctgttcttagggttgaattagaggactgggctgggaatgaagcttatgcagaatat
cacttccgggtaggctctgaggctgaaggctatgccctccaagtctcctcctatgaaggc
actgcgggtgatgctctgattgagggttccgtagaggaaggggcagagtacacctctcac
aacaacatgcagttcagcacctttgacagggatgcagaccagtgggaagagaactgtgca
gaagtctatgggggaggctggtggtataataactgccaagcagccaatctcaatggaatc
tactaccctgggggctcctatgacccaaggaataacagtccttatgagattgagaatgga
gtggtctgggtttcctttagaggggcagattattccctcagggctgttcgcatgaaaatt
aggccccttgtgacccaatag

DBGET integrated database retrieval system