KEGG   Homo sapiens (human): 2244Help
Entry
2244              CDS       T01001                                 

Gene name
FGB, HEL-S-78p
Definition
fibrinogen beta chain
Orthology
K03904  
fibrinogen beta chain
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Disease
H00222  
Afibrinogenemia
H00223  
Inherited thrombophilia
Class
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4q28
AA seq 432 aa AA seqDB search
MKRMVSWSFHKLKTMKHLLLLLLCVFLVKSQGVNDNEEGFFSARGHRPLDKKREEALLQQ
ERPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKH
QLYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGK
ECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPY
KQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGF
TVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSD
PRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRK
MSMKIRPFFPQQ
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggatggtttcttggagcttccacaaacttaaaaccatgaaacatctattattg
ctactattgtgtgtttttctagttaagtcccaaggtgtcaacgacaatgaggagggtttc
ttcagtgcccgtggtcatcgaccccttgacaagaagagagaagaggctttgctacaacag
gaaaggccaatcagaaatagtgttgatgagttaaataacaatgtggaagctgtttcccag
acctcctcttcttcctttcagtacatgtatttgctgaaagacctgtggcaaaagaggcag
aagcaagtaaaagataatgaaaatgtagtcaatgagtactcctcagaactggaaaagcac
caattatatatagatgagactgtgaatagcaatatcccaactaaccttcgtgtgcttcgt
tcaatcctggaaaacctgagaagcaaaatacaaaagttagaatctgatgtctcagctcaa
atggaatattgtcgcaccccatgcactgtcagttgcaatattcctgtggtgtctggcaaa
gaatgtgaggaaattatcaggaaaggaggtgaaacatctgaaatgtatctcattcaacct
gacagttctgtcaaaccgtatagagtatactgtgacatgaatacagaaaatggaggatgg
acagtgattcagaaccgtcaagacggtagtgttgactttggcaggaaatgggatccatat
aaacagggatttggaaatgttgcaaccaacacagatgggaagaattactgtggcctacca
ggtgaatattggcttggaaatgataaaattagccagcttaccaggatgggacccacagaa
cttttgatagaaatggaggactggaaaggagacaaagtaaaggctcactatggaggattc
actgtacagaatgaagccaacaaataccagatctcagtgaacaaatacagaggaacagcc
ggtaatgccctcatggatggagcatctcagctgatgggagaaaacaggaccatgaccatt
cacaacggcatgttcttcagcacgtatgacagagacaatgacggctggttaacatcagat
cccagaaaacagtgttctaaagaagacggtggtggatggtggtataatagatgtcatgca
gccaatccaaacggcagatactactggggtggacagtacacctgggacatggcaaagcat
ggcacagatgatggtgtagtatggatgaattggaaggggtcatggtactcaatgaggaag
atgagtatgaagatcaggcccttcttcccacagcaatag

DBGET integrated database retrieval system