KEGG   Homo sapiens (human): 2248Help
Entry
2248              CDS       T01001                                 

Gene name
FGF3, HBGF-3, INT2
Definition
(RefSeq) fibroblast growth factor 3
  KO
K04358  fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Disease
H00041  Kaposi's sarcoma
H00605  Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2248 (FGF3)
   04015 Rap1 signaling pathway
    2248 (FGF3)
   04010 MAPK signaling pathway
    2248 (FGF3)
   04151 PI3K-Akt signaling pathway
    2248 (FGF3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2248 (FGF3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2248 (FGF3)
   05226 Gastric cancer
    2248 (FGF3)
   05218 Melanoma
    2248 (FGF3)
   05224 Breast cancer
    2248 (FGF3)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2248 (FGF3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2248 (FGF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF
Motif
Other DBs
NCBI-GeneID: 2248
NCBI-ProteinID: NP_005238
OMIM: 164950
HGNC: 3681
Ensembl: ENSG00000186895
Vega: OTTHUMG00000167888
Pharos: P11487(Tbio)
UniProt: P11487
LinkDB All DBs
Position
11q13.3
AA seq 239 aa AA seqDB search
MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP
SGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVER
IHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLP
RVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgggcctaatctggctgctactgctcagcctgctggagcccggctggcccgcagcgggc
cctggggcgcggttgcggcgcgatgcgggcggccgtggcggcgtctacgagcaccttggc
ggggcgccccggcgccgcaagctctactgcgccacgaagtaccacctccagctgcacccg
agcggccgcgtcaacggcagcctggagaacagcgcctacagtattttggagataacggca
gtggaggtgggcattgtggccatcaggggtctcttctccgggcggtacctggccatgaac
aagaggggacgactctatgcttcggagcactacagcgccgagtgcgagtttgtggagcgg
atccacgagctgggctataatacgtatgcctcccggctgtaccggacggtgtctagtacg
cctggggcccgccggcagcccagcgccgagagactgtggtacgtgtctgtgaacggcaag
ggccggccccgcaggggcttcaagacccgccgcacacagaagtcctccctgttcctgccc
cgcgtgctggaccacagggaccacgagatggtgcggcagctacagagtgggctgcccaga
ccccctggtaagggggtccagccccgacggcggcggcagaagcagagcccggataacctg
gagccctctcacgttcaggcttcgagactgggctcccagctggaggccagtgcgcactag

DBGET integrated database retrieval system