KEGG   Homo sapiens (human): 2248Help
Entry
2248              CDS       T01001                                 

Gene name
FGF3, HBGF-3, INT2
Definition
fibroblast growth factor 3
Orthology
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Disease
H00041  
Kaposi's sarcoma
H00605  
Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2248 (FGF3)
   04015 Rap1 signaling pathway
    2248 (FGF3)
   04010 MAPK signaling pathway
    2248 (FGF3)
   04151 PI3K-Akt signaling pathway
    2248 (FGF3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2248 (FGF3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2248 (FGF3)
   05218 Melanoma
    2248 (FGF3)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
  2248 (FGF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
LinkDB All DBs
Position
11q13
AA seq 239 aa AA seqDB search
MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP
SGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVER
IHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLP
RVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgggcctaatctggctgctactgctcagcctgctggagcccggctggcccgcagcgggc
cctggggcgcggttgcggcgcgatgcgggcggccgtggcggcgtctacgagcaccttggc
ggggcgccccggcgccgcaagctctactgcgccacgaagtaccacctccagctgcacccg
agcggccgcgtcaacggcagcctggagaacagcgcctacagtattttggagataacggca
gtggaggtgggcattgtggccatcaggggtctcttctccgggcggtacctggccatgaac
aagaggggacgactctatgcttcggagcactacagcgccgagtgcgagtttgtggagcgg
atccacgagctgggctataatacgtatgcctcccggctgtaccggacggtgtctagtacg
cctggggcccgccggcagcccagcgccgagagactgtggtacgtgtctgtgaacggcaag
ggccggccccgcaggggcttcaagacccgccgcacacagaagtcctccctgttcctgccc
cgcgtgctggaccacagggaccacgagatggtgcggcagctacagagtgggctgcccaga
ccccctggtaagggggtccagccccgacggcggcggcagaagcagagcccggataacctg
gagccctctcacgttcaggcttcgagactgggctcccagctggaggccagtgcgcactag

DBGET integrated database retrieval system