KEGG   Homo sapiens (human): 2253Help
Entry
2253              CDS       T01001                                 

Gene name
FGF8, AIGF, FGF-8, HBGF-8, HH6, KAL6
Definition
fibroblast growth factor 8 (androgen-induced)
Orthology
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Disease
H00255  
Hypogonadotropic hypogonadism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2253 (FGF8)
   04015 Rap1 signaling pathway
    2253 (FGF8)
   04010 MAPK signaling pathway
    2253 (FGF8)
   04151 PI3K-Akt signaling pathway
    2253 (FGF8)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2253 (FGF8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2253 (FGF8)
   05218 Melanoma
    2253 (FGF8)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
  2253 (FGF8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
10q24
AA seq 140 aa AA seqDB search
MAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLE
NNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLN
YPPFTRSLRGSQRTWAPEPR
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggacggcgaccccttcgcaaagctcatcgtggagacggacacctttggaagc
agagttcgagtccgaggagccgagacgggcctctacatctgcatgaacaagaaggggaag
ctgatcgccaagagcaacggcaaaggcaaggactgcgtcttcacggagattgtgctggag
aacaactacacagcgctgcagaatgccaagtacgagggctggtacatggccttcacccgc
aagggccggccccgcaagggctccaagacgcggcagcaccagcgtgaggtccacttcatg
aagcggctgccccggggccaccacaccaccgagcagagcctgcgcttcgagttcctcaac
tacccgcccttcacgcgcagcctgcgcggcagccagaggacttgggcccccgagccccga
tag

DBGET integrated database retrieval system