KEGG   Homo sapiens (human): 2260Help
Entry
2260              CDS       T01001                                 

Gene name
FGFR1, BFGFR, CD331, CEK, FGFBR, FGFR-1, FLG, FLT-2, FLT2, HBGFR, HH2, HRTFDS, KAL2, N-SAM, OGD, bFGF-R-1
Definition
(RefSeq) fibroblast growth factor receptor 1 (EC:2.7.10.1)
  KO
K04362  
fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Adherens junction
Signaling pathways regulating pluripotency of stem cells
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Prostate cancer
Melanoma
Central carbon metabolism in cancer
Disease
H00255  
Hypogonadotropic hypogonadism
H00443  
Osteoglophonic dysplasia (OD)
H00458  
Craniosynostosis
H00516  
Isolated orofacial clefts
H01207  
Trigonocephaly
Drug target
Regorafenib: 
Lenvatinib: 
Nintedanib: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2260 (FGFR1)
   04015 Rap1 signaling pathway
    2260 (FGFR1)
   04010 MAPK signaling pathway
    2260 (FGFR1)
   04151 PI3K-Akt signaling pathway
    2260 (FGFR1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2260 (FGFR1)
  Cellular commiunity
   04520 Adherens junction
    2260 (FGFR1)
   04550 Signaling pathways regulating pluripotency of stem cells
    2260 (FGFR1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2260 (FGFR1)
   05230 Central carbon metabolism in cancer
    2260 (FGFR1)
   05205 Proteoglycans in cancer
    2260 (FGFR1)
   05218 Melanoma
    2260 (FGFR1)
   05215 Prostate cancer
    2260 (FGFR1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2260 (FGFR1)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  FGFR family [OT]
   2260 (FGFR1)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class IV (FGF receptor family)
   2260 (FGFR1)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class IV (FGF receptor family)
   2260 (FGFR1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   5/2 subfamily
    NCAM; neural cell adhesion molecule [KO:K06491]
     2260 (FGFR1)
   6/5 subfamily
    L1CAM; L1 cell adhesion molecule [KO:K06550]
     2260 (FGFR1)
 5. Cadherin Family
  Classic Cadherins
   Vertebrate Type I classic cadherins
    CDH2; cadherin 2, type 1, N-cadherin [KO:K06736]
     2260 (FGFR1)
Cellular antigens [BR:hsa04090]
 Proteins
  2260 (FGFR1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2260 (FGFR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
8p11.23-p11.22
AA seq 822 aa AA seqDB search
MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSF
PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgtggagctggaagtgcctcctcttctgggctgtgctggtcacagccacactctgcacc
gctaggccgtccccgaccttgcctgaacaagcccagccctggggagcccctgtggaagtg
gagtccttcctggtccaccccggtgacctgctgcagcttcgctgtcggctgcgggacgat
gtgcagagcatcaactggctgcgggacggggtgcagctggcggaaagcaaccgcacccgc
atcacaggggaggaggtggaggtgcaggactccgtgcccgcagactccggcctctatgct
tgcgtaaccagcagcccctcgggcagtgacaccacctacttctccgtcaatgtttcagat
gctctcccctcctcggaggatgatgatgatgatgatgactcctcttcagaggagaaagaa
acagataacaccaaaccaaaccgtatgcccgtagctccatattggacatccccagaaaag
atggaaaagaaattgcatgcagtgccggctgccaagacagtgaagttcaaatgcccttcc
agtgggaccccaaaccccacactgcgctggttgaaaaatggcaaagaattcaaacctgac
cacagaattggaggctacaaggtccgttatgccacctggagcatcataatggactctgtg
gtgccctctgacaagggcaactacacctgcattgtggagaatgagtacggcagcatcaac
cacacataccagctggatgtcgtggagcggtcccctcaccggcccatcctgcaagcaggg
ttgcccgccaacaaaacagtggccctgggtagcaacgtggagttcatgtgtaaggtgtac
agtgacccgcagccgcacatccagtggctaaagcacatcgaggtgaatgggagcaagatt
ggcccagacaacctgccttatgtccagatcttgaagactgctggagttaataccaccgac
aaagagatggaggtgcttcacttaagaaatgtctcctttgaggacgcaggggagtatacg
tgcttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaa
gccctggaagagaggccggcagtgatgacctcgcccctgtacctggagatcatcatctat
tgcacaggggccttcctcatctcctgcatggtggggtcggtcatcgtctacaagatgaag
agtggtaccaagaagagtgacttccacagccagatggctgtgcacaagctggccaagagc
atccctctgcgcagacaggtaacagtgtctgctgactccagtgcatccatgaactctggg
gttcttctggttcggccatcacggctctcctccagtgggactcccatgctagcaggggtc
tctgagtatgagcttcccgaagaccctcgctgggagctgcctcgggacagactggtctta
ggcaaacccctgggagagggctgctttgggcaggtggtgttggcagaggctatcgggctg
gacaaggacaaacccaaccgtgtgaccaaagtggctgtgaagatgttgaagtcggacgca
acagagaaagacttgtcagacctgatctcagaaatggagatgatgaagatgatcgggaag
cataagaatatcatcaacctgctgggggcctgcacgcaggatggtcccttgtatgtcatc
gtggagtatgcctccaagggcaacctgcgggagtacctgcaggcccggaggcccccaggg
ctggaatactgctacaaccccagccacaacccagaggagcagctctcctccaaggacctg
gtgtcctgcgcctaccaggtggcccgaggcatggagtatctggcctccaagaagtgcata
caccgagacctggcagccaggaatgtcctggtgacagaggacaatgtgatgaagatagca
gactttggcctcgcacgggacattcaccacatcgactactataaaaagacaaccaacggc
cgactgcctgtgaagtggatggcacccgaggcattatttgaccggatctacacccaccag
agtgatgtgtggtctttcggggtgctcctgtgggagatcttcactctgggcggctcccca
taccccggtgtgcctgtggaggaacttttcaagctgctgaaggagggtcaccgcatggac
aagcccagtaactgcaccaacgagctgtacatgatgatgcgggactgctggcatgcagtg
ccctcacagagacccaccttcaagcagctggtggaagacctggaccgcatcgtggccttg
acctccaaccaggagtacctggacctgtccatgcccctggaccagtactcccccagcttt
cccgacacccggagctctacgtgctcctcaggggaggattccgtcttctctcatgagccg
ctgcccgaggagccctgcctgccccgacacccagcccagcttgccaatggcggactcaaa
cgccgctga

DBGET integrated database retrieval system