KEGG   Homo sapiens (human): 2261Help
Entry
2261              CDS       T01001                                 

Gene name
FGFR3, ACH, CD333, CEK2, HSFGFR3EX, JTK4
Definition
(RefSeq) fibroblast growth factor receptor 3
  KO
K05094  fibroblast growth factor receptor 3 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04144  Endocytosis
hsa04151  PI3K-Akt signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05219  Bladder cancer
hsa05230  Central carbon metabolism in cancer
Network
N00011  Mutation-activated FGFR3 to RAS-ERK signaling pathway
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Disease
H00010  Multiple myeloma
H00022  Bladder cancer
H00458  Craniosynostosis
H00505  FGFR3-related short limb skeletal dysplasias
H00642  Lacrimo-auriculo-dento-digital syndrome (LADD)
H00997  CATSHL syndrome
H01749  Achondroplasia
H01750  Thanatophoric dysplasia
H01754  Crouzon syndrome
H01990  Muenke syndrome
Drug target
Dovitinib lactate: D08907
Erdafitinib: D10927
Lenvatinib (DG01362): D09919 D09920
Nintedanib (DG01374): D10396 D10481
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2261 (FGFR3)
   04015 Rap1 signaling pathway
    2261 (FGFR3)
   04010 MAPK signaling pathway
    2261 (FGFR3)
   04151 PI3K-Akt signaling pathway
    2261 (FGFR3)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    2261 (FGFR3)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    2261 (FGFR3)
  Cell motility
   04810 Regulation of actin cytoskeleton
    2261 (FGFR3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2261 (FGFR3)
   05230 Central carbon metabolism in cancer
    2261 (FGFR3)
   05206 MicroRNAs in cancer
    2261 (FGFR3)
   05219 Bladder cancer
    2261 (FGFR3)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    2261 (FGFR3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2261 (FGFR3)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases
  FGFR family [OT]
   2261 (FGFR3)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class IV (FGF receptor family)
   2261 (FGFR3)
CD molecules [BR:hsa04090]
 Proteins
  2261 (FGFR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 Ig_2 ig V-set C2-set_2 DUF1533
Motif
Other DBs
NCBI-GeneID: 2261
NCBI-ProteinID: NP_000133
OMIM: 134934
HGNC: 3690
Ensembl: ENSG00000068078
Vega: OTTHUMG00000121148
Pharos: P22607(Tclin)
UniProt: P22607 Q0IJ44
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4p16.3
AA seq 806 aa AA seqDB search
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELS
CPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCH
FSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAG
NPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQT
YTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP
DGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAE
EELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLK
RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGE
GCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIIN
LLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQ
VARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKW
MAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCT
HDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSS
SSSGDDSVFAHDLLPPAPPSSGGSRT
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcccctgcctgcgccctcgcgctctgcgtggccgtggccatcgtggccggcgcc
tcctcggagtccttggggacggagcagcgcgtcgtggggcgagcggcagaagtcccgggc
ccagagcccggccagcaggagcagttggtcttcggcagcggggatgctgtggagctgagc
tgtcccccgcccgggggtggtcccatggggcccactgtctgggtcaaggatggcacaggg
ctggtgccctcggagcgtgtcctggtggggccccagcggctgcaggtgctgaatgcctcc
cacgaggactccggggcctacagctgccggcagcggctcacgcagcgcgtactgtgccac
ttcagtgtgcgggtgacagacgctccatcctcgggagatgacgaagacggggaggacgag
gctgaggacacaggtgtggacacaggggccccttactggacacggcccgagcggatggac
aagaagctgctggccgtgccggccgccaacaccgtccgcttccgctgcccagccgctggc
aaccccactccctccatctcctggctgaagaacggcagggagttccgcggcgagcaccgc
attggaggcatcaagctgcggcatcagcagtggagcctggtcatggaaagcgtggtgccc
tcggaccgcggcaactacacctgcgtcgtggagaacaagtttggcagcatccggcagacg
tacacgctggacgtgctggagcgctccccgcaccggcccatcctgcaggcggggctgccg
gccaaccagacggcggtgctgggcagcgacgtggagttccactgcaaggtgtacagtgac
gcacagccccacatccagtggctcaagcacgtggaggtgaatggcagcaaggtgggcccg
gacggcacaccctacgttaccgtgctcaagacggcgggcgctaacaccaccgacaaggag
ctagaggttctctccttgcacaacgtcacctttgaggacgccggggagtacacctgcctg
gcgggcaattctattgggttttctcatcactctgcgtggctggtggtgctgccagccgag
gaggagctggtggaggctgacgaggcgggcagtgtgtatgcaggcatcctcagctacggg
gtgggcttcttcctgttcatcctggtggtggcggctgtgacgctctgccgcctgcgcagc
ccccccaagaaaggcctgggctcccccaccgtgcacaagatctcccgcttcccgctcaag
cgacaggtgtccctggagtccaacgcgtccatgagctccaacacaccactggtgcgcatc
gcaaggctgtcctcaggggagggccccacgctggccaatgtctccgagctcgagctgcct
gccgaccccaaatgggagctgtctcgggcccggctgaccctgggcaagccccttggggag
ggctgcttcggccaggtggtcatggcggaggccatcggcattgacaaggaccgggccgcc
aagcctgtcaccgtagccgtgaagatgctgaaagacgatgccactgacaaggacctgtcg
gacctggtgtctgagatggagatgatgaagatgatcgggaaacacaaaaacatcatcaac
ctgctgggcgcctgcacgcagggcgggcccctgtacgtgctggtggagtacgcggccaag
ggtaacctgcgggagtttctgcgggcgcggcggcccccgggcctggactactccttcgac
acctgcaagccgcccgaggagcagctcaccttcaaggacctggtgtcctgtgcctaccag
gtggcccggggcatggagtacttggcctcccagaagtgcatccacagggacctggctgcc
cgcaatgtgctggtgaccgaggacaacgtgatgaagatcgcagacttcgggctggcccgg
gacgtgcacaacctcgactactacaagaagacaaccaacggccggctgcccgtgaagtgg
atggcgcctgaggccttgtttgaccgagtctacactcaccagagtgacgtctggtccttt
ggggtcctgctctgggagatcttcacgctggggggctccccgtaccccggcatccctgtg
gaggagctcttcaagctgctgaaggagggccaccgcatggacaagcccgccaactgcaca
cacgacctgtacatgatcatgcgggagtgctggcatgccgcgccctcccagaggcccacc
ttcaagcagctggtggaggacctggaccgtgtccttaccgtgacgtccaccgacgagtac
ctggacctgtcggcgcctttcgagcagtactccccgggtggccaggacacccccagctcc
agctcctcaggggacgactccgtgtttgcccacgacctgctgcccccggccccacccagc
agtgggggctcgcggacgtga

DBGET integrated database retrieval system