KEGG   Homo sapiens (human): 2263Help
Entry
2263              CDS       T01001                                 

Gene name
FGFR2, BBDS, BEK, BFR-1, CD332, CEK3, CFD1, ECT1, JWS, K-SAM, KGFR, TK14, TK25
Definition
fibroblast growth factor receptor 2 (EC:2.7.10.1)
Orthology
K05093  
fibroblast growth factor receptor 2 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Signaling pathways regulating pluripotency of stem cells
Regulation of actin cytoskeleton
Pathways in cancer
Prostate cancer
Disease
H00018  
Gastric cancer
H00458  
Craniosynostosis
H00642  
Lacrimo-auriculo-dento-digital syndrome (LADD)
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2263 (FGFR2)
   04015 Rap1 signaling pathway
    2263 (FGFR2)
   04010 MAPK signaling pathway
    2263 (FGFR2)
   04151 PI3K-Akt signaling pathway
    2263 (FGFR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    2263 (FGFR2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    2263 (FGFR2)
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    2263 (FGFR2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2263 (FGFR2)
   05215 Prostate cancer
    2263 (FGFR2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2263 (FGFR2)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  FGFR family [OT]
   2263 (FGFR2)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class IV (FGF receptor family)
   2263 (FGFR2)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class IV (FGF receptor family)
   2263 (FGFR2)
Cellular antigens [BR:hsa04090]
 Proteins
  2263 (FGFR2)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
  2263 (FGFR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
10q26
AA seq 821 aa AA seqDB search
MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEV
RCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYF
MVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP
AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSI
NHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSK
YGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVL
PAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTK
RIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDK
LTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKM
IGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTF
KDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKT
TNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGH
RMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYS
PSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggtcagctggggtcgtttcatctgcctggtcgtggtcaccatggcaaccttgtccctg
gcccggccctccttcagtttagttgaggataccacattagagccagaagagccaccaacc
aaataccaaatctctcaaccagaagtgtacgtggctgcgccaggggagtcgctagaggtg
cgctgcctgttgaaagatgccgccgtgatcagttggactaaggatggggtgcacttgggg
cccaacaataggacagtgcttattggggagtacttgcagataaagggcgccacgcctaga
gactccggcctctatgcttgtactgccagtaggactgtagacagtgaaacttggtacttc
atggtgaatgtcacagatgccatctcatccggagatgatgaggatgacaccgatggtgcg
gaagattttgtcagtgagaacagtaacaacaagagagcaccatactggaccaacacagaa
aagatggaaaagcggctccatgctgtgcctgcggccaacactgtcaagtttcgctgccca
gccggggggaacccaatgccaaccatgcggtggctgaaaaacgggaaggagtttaagcag
gagcatcgcattggaggctacaaggtacgaaaccagcactggagcctcattatggaaagt
gtggtcccatctgacaagggaaattatacctgtgtagtggagaatgaatacgggtccatc
aatcacacgtaccacctggatgttgtggagcgatcgcctcaccggcccatcctccaagcc
ggactgccggcaaatgcctccacagtggtcggaggagacgtagagtttgtctgcaaggtt
tacagtgatgcccagccccacatccagtggatcaagcacgtggaaaagaacggcagtaaa
tacgggcccgacgggctgccctacctcaaggttctcaaggccgccggtgttaacaccacg
gacaaagagattgaggttctctatattcggaatgtaacttttgaggacgctggggaatat
acgtgcttggcgggtaattctattgggatatcctttcactctgcatggttgacagttctg
ccagcgcctggaagagaaaaggagattacagcttccccagactacctggagatagccatt
tactgcataggggtcttcttaatcgcctgtatggtggtaacagtcatcctgtgccgaatg
aagaacacgaccaagaagccagacttcagcagccagccggctgtgcacaagctgaccaaa
cgtatccccctgcggagacaggtaacagtttcggctgagtccagctcctccatgaactcc
aacaccccgctggtgaggataacaacacgcctctcttcaacggcagacacccccatgctg
gcaggggtctccgagtatgaacttccagaggacccaaaatgggagtttccaagagataag
ctgacactgggcaagcccctgggagaaggttgctttgggcaagtggtcatggcggaagca
gtgggaattgacaaagacaagcccaaggaggcggtcaccgtggccgtgaagatgttgaaa
gatgatgccacagagaaagacctttctgatctggtgtcagagatggagatgatgaagatg
attgggaaacacaagaatatcataaatcttcttggagcctgcacacaggatgggcctctc
tatgtcatagttgagtatgcctctaaaggcaacctccgagaatacctccgagcccggagg
ccacccgggatggagtactcctatgacattaaccgtgttcctgaggagcagatgaccttc
aaggacttggtgtcatgcacctaccagctggccagaggcatggagtacttggcttcccaa
aaatgtattcatcgagatttagcagccagaaatgttttggtaacagaaaacaatgtgatg
aaaatagcagactttggactcgccagagatatcaacaatatagactattacaaaaagacc
accaatgggcggcttccagtcaagtggatggctccagaagccctgtttgatagagtatac
actcatcagagtgatgtctggtccttcggggtgttaatgtgggagatcttcactttaggg
ggctcgccctacccagggattcccgtggaggaactttttaagctgctgaaggaaggacac
agaatggataagccagccaactgcaccaacgaactgtacatgatgatgagggactgttgg
catgcagtgccctcccagagaccaacgttcaagcagttggtagaagacttggatcgaatt
ctcactctcacaaccaatgaggaatacttggacctcagccaacctctcgaacagtattca
cctagttaccctgacacaagaagttcttgttcttcaggagatgattctgttttttctcca
gaccccatgccttacgaaccatgccttcctcagtatccacacataaacggcagtgttaaa
acatga

DBGET integrated database retrieval system