KEGG   Homo sapiens (human): 2264Help
Entry
2264              CDS       T01001                                 

Gene name
FGFR4, CD334, JTK2, TKF
Definition
fibroblast growth factor receptor 4 (EC:2.7.10.1)
Orthology
K05095  
fibroblast growth factor receptor 4 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2264 (FGFR4)
   04015 Rap1 signaling pathway
    2264 (FGFR4)
   04010 MAPK signaling pathway
    2264 (FGFR4)
   04151 PI3K-Akt signaling pathway
    2264 (FGFR4)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    2264 (FGFR4)
  Cell motility
   04810 Regulation of actin cytoskeleton
    2264 (FGFR4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2264 (FGFR4)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  FGFR family [OT]
   2264 (FGFR4)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class IV (FGF receptor family)
   2264 (FGFR4)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class IV (FGF receptor family)
   2264 (FGFR4)
Cellular antigens [BR:hsa04090]
 Proteins
  2264 (FGFR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
5q35.2
AA seq 802 aa AA seqDB search
MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRA
ERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDS
LTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTP
TIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLD
VLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP
YVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTA
AAPEARYTDIILYASGSLALAVLLLLAGLYRGQALHGRHPRPPATVQKLSRFPLARQFSL
ESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQ
VVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVC
TQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGM
QYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEA
LFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYG
LMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDS
VFSHDPLPLGSSSFPFGSGVQT
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgctgctggccctgttgggggtcctgctgagtgtgcctgggcctccagtcttg
tccctggaggcctctgaggaagtggagcttgagccctgcctggctcccagcctggagcag
caagagcaggagctgacagtagcccttgggcagcctgtgcgtctgtgctgtgggcgggct
gagcgtggtggccactggtacaaggagggcagtcgcctggcacctgctggccgtgtacgg
ggctggaggggccgcctagagattgccagcttcctacctgaggatgctggccgctacctc
tgcctggcacgaggctccatgatcgtcctgcagaatctcaccttgattacaggtgactcc
ttgacctccagcaacgatgatgaggaccccaagtcccatagggacccctcgaataggcac
agttacccccagcaagcaccctactggacacacccccagcgcatggagaagaaactgcat
gcagtacctgcggggaacaccgtcaagttccgctgtccagctgcaggcaaccccacgccc
accatccgctggcttaaggatggacaggcctttcatggggagaaccgcattggaggcatt
cggctgcgccatcagcactggagtctcgtgatggagagcgtggtgccctcggaccgcggc
acatacacctgcctggtagagaacgctgtgggcagcatccgctataactacctgctagat
gtgctggagcggtccccgcaccggcccatcctgcaggccgggctcccggccaacaccaca
gccgtggtgggcagcgacgtggagctgctgtgcaaggtgtacagcgatgcccagccccac
atccagtggctgaagcacatcgtcatcaacggcagcagcttcggagccgacggtttcccc
tatgtgcaagtcctaaagactgcagacatcaatagctcagaggtggaggtcctgtacctg
cggaacgtgtcagccgaggacgcaggcgagtacacctgcctcgcaggcaattccatcggc
ctctcctaccagtctgcctggctcacggtgctgccagaggaggaccccacatggaccgca
gcagcgcccgaggccaggtatacggacatcatcctgtacgcgtcgggctccctggccttg
gctgtgctcctgctgctggccgggctgtatcgagggcaggcgctccacggccggcacccc
cgcccgcccgccactgtgcagaagctctcccgcttccctctggcccgacagttctccctg
gagtcaggctcttccggcaagtcaagctcatccctggtacgaggcgtgcgtctctcctcc
agcggccccgccttgctcgccggcctcgtgagtctagatctacctctcgacccactatgg
gagttcccccgggacaggctggtgcttgggaagcccctaggcgagggctgctttggccag
gtagtacgtgcagaggcctttggcatggaccctgcccggcctgaccaagccagcactgtg
gccgtcaagatgctcaaagacaacgcctctgacaaggacctggccgacctggtctcggag
atggaggtgatgaagctgatcggccgacacaagaacatcatcaacctgcttggtgtctgc
acccaggaagggcccctgtacgtgatcgtggagtgcgccgccaagggaaacctgcgggag
ttcctgcgggcccggcgccccccaggccccgacctcagccccgacggtcctcggagcagt
gaggggccgctctccttcccagtcctggtctcctgcgcctaccaggtggcccgaggcatg
cagtatctggagtcccggaagtgtatccaccgggacctggctgcccgcaatgtgctggtg
actgaggacaatgtgatgaagattgctgactttgggctggcccgcggcgtccaccacatt
gactactataagaaaaccagcaacggccgcctgcctgtgaagtggatggcgcccgaggcc
ttgtttgaccgggtgtacacacaccagagtgacgtgtggtcttttgggatcctgctatgg
gagatcttcaccctcgggggctccccgtatcctggcatcccggtggaggagctgttctcg
ctgctgcgggagggacatcggatggaccgacccccacactgccccccagagctgtacggg
ctgatgcgtgagtgctggcacgcagcgccctcccagaggcctaccttcaagcagctggtg
gaggcgctggacaaggtcctgctggccgtctctgaggagtacctcgacctccgcctgacc
ttcggaccctattccccctctggtggggacgccagcagcacctgctcctccagcgattct
gtcttcagccacgaccccctgccattgggatccagctccttccccttcgggtctggggtg
cagacatga

DBGET integrated database retrieval system