KEGG   Homo sapiens (human): 2264Help
Entry
2264              CDS       T01001                                 

Gene name
FGFR4, CD334, JTK2, TKF
Definition
fibroblast growth factor receptor 4 (EC:2.7.10.1)
Orthology
K05095  
fibroblast growth factor receptor 4 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
5q35.2
AA seq 802 aa AA seqDB search
MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRA
ERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDS
LTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTP
TIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLD
VLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP
YVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTA
AAPEARYTDIILYASGSLALAVLLLLAGLYRGQALHGRHPRPPATVQKLSRFPLARQFSL
ESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQ
VVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVC
TQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGM
QYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEA
LFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYG
LMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDS
VFSHDPLPLGSSSFPFGSGVQT
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgctgctggccctgttgggggtcctgctgagtgtgcctgggcctccagtcttg
tccctggaggcctctgaggaagtggagcttgagccctgcctggctcccagcctggagcag
caagagcaggagctgacagtagcccttgggcagcctgtgcgtctgtgctgtgggcgggct
gagcgtggtggccactggtacaaggagggcagtcgcctggcacctgctggccgtgtacgg
ggctggaggggccgcctagagattgccagcttcctacctgaggatgctggccgctacctc
tgcctggcacgaggctccatgatcgtcctgcagaatctcaccttgattacaggtgactcc
ttgacctccagcaacgatgatgaggaccccaagtcccatagggacccctcgaataggcac
agttacccccagcaagcaccctactggacacacccccagcgcatggagaagaaactgcat
gcagtacctgcggggaacaccgtcaagttccgctgtccagctgcaggcaaccccacgccc
accatccgctggcttaaggatggacaggcctttcatggggagaaccgcattggaggcatt
cggctgcgccatcagcactggagtctcgtgatggagagcgtggtgccctcggaccgcggc
acatacacctgcctggtagagaacgctgtgggcagcatccgctataactacctgctagat
gtgctggagcggtccccgcaccggcccatcctgcaggccgggctcccggccaacaccaca
gccgtggtgggcagcgacgtggagctgctgtgcaaggtgtacagcgatgcccagccccac
atccagtggctgaagcacatcgtcatcaacggcagcagcttcggagccgacggtttcccc
tatgtgcaagtcctaaagactgcagacatcaatagctcagaggtggaggtcctgtacctg
cggaacgtgtcagccgaggacgcaggcgagtacacctgcctcgcaggcaattccatcggc
ctctcctaccagtctgcctggctcacggtgctgccagaggaggaccccacatggaccgca
gcagcgcccgaggccaggtatacggacatcatcctgtacgcgtcgggctccctggccttg
gctgtgctcctgctgctggccgggctgtatcgagggcaggcgctccacggccggcacccc
cgcccgcccgccactgtgcagaagctctcccgcttccctctggcccgacagttctccctg
gagtcaggctcttccggcaagtcaagctcatccctggtacgaggcgtgcgtctctcctcc
agcggccccgccttgctcgccggcctcgtgagtctagatctacctctcgacccactatgg
gagttcccccgggacaggctggtgcttgggaagcccctaggcgagggctgctttggccag
gtagtacgtgcagaggcctttggcatggaccctgcccggcctgaccaagccagcactgtg
gccgtcaagatgctcaaagacaacgcctctgacaaggacctggccgacctggtctcggag
atggaggtgatgaagctgatcggccgacacaagaacatcatcaacctgcttggtgtctgc
acccaggaagggcccctgtacgtgatcgtggagtgcgccgccaagggaaacctgcgggag
ttcctgcgggcccggcgccccccaggccccgacctcagccccgacggtcctcggagcagt
gaggggccgctctccttcccagtcctggtctcctgcgcctaccaggtggcccgaggcatg
cagtatctggagtcccggaagtgtatccaccgggacctggctgcccgcaatgtgctggtg
actgaggacaatgtgatgaagattgctgactttgggctggcccgcggcgtccaccacatt
gactactataagaaaaccagcaacggccgcctgcctgtgaagtggatggcgcccgaggcc
ttgtttgaccgggtgtacacacaccagagtgacgtgtggtcttttgggatcctgctatgg
gagatcttcaccctcgggggctccccgtatcctggcatcccggtggaggagctgttctcg
ctgctgcgggagggacatcggatggaccgacccccacactgccccccagagctgtacggg
ctgatgcgtgagtgctggcacgcagcgccctcccagaggcctaccttcaagcagctggtg
gaggcgctggacaaggtcctgctggccgtctctgaggagtacctcgacctccgcctgacc
ttcggaccctattccccctctggtggggacgccagcagcacctgctcctccagcgattct
gtcttcagccacgaccccctgccattgggatccagctccttccccttcgggtctggggtg
cagacatga

DBGET integrated database retrieval system