KEGG   Homo sapiens (human): 2266Help
Entry
2266              CDS       T01001                                 

Gene name
FGG
Definition
(RefSeq) fibrinogen gamma chain
  KO
K03905  fibrinogen gamma chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa04611  Platelet activation
hsa05150  Staphylococcus aureus infection
Disease
H00222  Afibrinogenemia
H00223  Inherited thrombophilia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    2266 (FGG)
   04611 Platelet activation
    2266 (FGG)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    2266 (FGG)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2266 (FGG)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   2266 (FGG)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   2266 (FGG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C Fib_alpha Reo_sigmaC Syntaxin Spc7 CEP209_CC5 TMF_DNA_bd
Motif
Other DBs
NCBI-GeneID: 2266
NCBI-ProteinID: NP_068656
OMIM: 134850
HGNC: 3694
Ensembl: ENSG00000171557
Vega: OTTHUMG00000150329
Pharos: P02679(Tbio)
UniProt: P02679
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4q32.1
AA seq 453 aa AA seqDB search
MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQT
KVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIM
KYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQ
DIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEG
FGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKY
RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGW
WMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
GEGQQHHLGGAKQVRPEHPAETEYDSLYPEDDL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagttggtccttgcacccccggaatttaattctctacttctatgctcttttatttctc
tcttcaacatgtgtagcatatgttgctaccagagacaactgctgcatcttagatgaaaga
ttcggtagttattgtccaactacctgtggcattgcagatttcctgtctacttatcaaacc
aaagtagacaaggatctacagtctttggaagacatcttacatcaagttgaaaacaaaaca
tcagaagtcaaacagctgataaaagcaatccaactcacttataatcctgatgaatcatca
aaaccaaatatgatagacgctgctactttgaagtccaggaaaatgttagaagaaattatg
aaatatgaagcatcgattttaacacatgactcaagtattcgatatttgcaggaaatatat
aattcaaataatcaaaagattgttaacctgaaagagaaggtagcccagcttgaagcacag
tgccaggaaccttgcaaagacacggtgcaaatccatgatatcactgggaaagattgtcaa
gacattgccaataagggagctaaacagagcgggctttactttattaaacctctgaaagct
aaccagcaattcttagtctactgtgaaatcgatgggtctggaaatggatggactgtgttt
cagaagagacttgatggcagtgtagatttcaagaaaaactggattcaatataaagaagga
tttggacatctgtctcctactggcacaacagaattttggctgggaaatgagaagattcat
ttgataagcacacagtctgccatcccatatgcattaagagtggaactggaagactggaat
ggcagaaccagtactgcagactatgccatgttcaaggtgggacctgaagctgacaagtac
cgcctaacatatgcctacttcgctggtggggatgctggagatgcctttgatggctttgat
tttggcgatgatcctagtgacaagtttttcacatcccataatggcatgcagttcagtacc
tgggacaatgacaatgataagtttgaaggcaactgtgctgaacaggatggatctggttgg
tggatgaacaagtgtcacgctggccatctcaatggagtttattaccaaggtggcacttac
tcaaaagcatctactcctaatggttatgataatggcattatttgggccacttggaaaacc
cggtggtattccatgaagaaaaccactatgaagataatcccattcaacagactcacaatt
ggagaaggacagcaacaccacctggggggagccaaacaggtcagaccagagcaccctgcg
gaaacagaatatgactcactttaccctgaggatgatttgtag

DBGET integrated database retrieval system