KEGG   Homo sapiens (human): 2266Help
Entry
2266              CDS       T01001                                 

Gene name
FGG
Definition
fibrinogen gamma chain
Orthology
K03905  
fibrinogen gamma chain
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Platelet activation
Staphylococcus aureus infection
Disease
H00222  
Afibrinogenemia
H00223  
Inherited thrombophilia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    2266 (FGG)
   04611 Platelet activation
    2266 (FGG)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    2266 (FGG)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2266 (FGG)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  2266 (FGG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4q28
AA seq 437 aa AA seqDB search
MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQT
KVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIM
KYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQ
DIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEG
FGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKY
RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGW
WMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
GEGQQHHLGGAKQAGDV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgagttggtccttgcacccccggaatttaattctctacttctatgctcttttatttctc
tcttcaacatgtgtagcatatgttgctaccagagacaactgctgcatcttagatgaaaga
ttcggtagttattgtccaactacctgtggcattgcagatttcctgtctacttatcaaacc
aaagtagacaaggatctacagtctttggaagacatcttacatcaagttgaaaacaaaaca
tcagaagtcaaacagctgataaaagcaatccaactcacttataatcctgatgaatcatca
aaaccaaatatgatagacgctgctactttgaagtccaggaaaatgttagaagaaattatg
aaatatgaagcatcgattttaacacatgactcaagtattcgatatttgcaggaaatatat
aattcaaataatcaaaagattgttaacctgaaagagaaggtagcccagcttgaagcacag
tgccaggaaccttgcaaagacacggtgcaaatccatgatatcactgggaaagattgtcaa
gacattgccaataagggagctaaacagagcgggctttactttattaaacctctgaaagct
aaccagcaattcttagtctactgtgaaatcgatgggtctggaaatggatggactgtgttt
cagaagagacttgatggcagtgtagatttcaagaaaaactggattcaatataaagaagga
tttggacatctgtctcctactggcacaacagaattttggctgggaaatgagaagattcat
ttgataagcacacagtctgccatcccatatgcattaagagtggaactggaagactggaat
ggcagaaccagtactgcagactatgccatgttcaaggtgggacctgaagctgacaagtac
cgcctaacatatgcctacttcgctggtggggatgctggagatgcctttgatggctttgat
tttggcgatgatcctagtgacaagtttttcacatcccataatggcatgcagttcagtacc
tgggacaatgacaatgataagtttgaaggcaactgtgctgaacaggatggatctggttgg
tggatgaacaagtgtcacgctggccatctcaatggagtttattaccaaggtggcacttac
tcaaaagcatctactcctaatggttatgataatggcattatttgggccacttggaaaacc
cggtggtattccatgaagaaaaccactatgaagataatcccattcaacagactcacaatt
ggagaaggacagcaacaccacctggggggagccaaacaggctggagacgtttaa

DBGET integrated database retrieval system