KEGG   Homo sapiens (human): 23136Help
Entry
23136             CDS       T01001                                 

Gene name
EPB41L3, 4.1B, DAL-1, DAL1
Definition
erythrocyte membrane protein band 4.1-like 3
Orthology
K06107  
erythrocyte membrane protein band 4.1
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Class
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
18p11.32
AA seq 883 aa AA seqDB search
MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQALEQFAAAAAHSTPVRR
EVTDKEQEFAARAAKQLEYQQLEDDKLSQKSSSSKLSRSPLKIVKKPKSMQCKVILLDGS
EYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAW
HFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDY
DPDECGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDL
HHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFE
STIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRRAS
ALIDRPAPYFERSSSKRYTMSRSLDGASVNENHEIYMKDSMSAAEVGTGQYATTKGISQT
NLITTVTPEKKAEEERDEEEDKRRKGEEVTPISAIRHEGKTDSERTDTAADGETTATESD
QEEDAELKAQELEKTQDDLMKHQTNISELKRTFLETSTDTAVTNEWEKRLSTSPVRLAAR
QEDAPMIEPLVPEETKQSSGEKLMDGSEIFSLLESARKPTEFIGGVTSTSQSWVQKMETK
TESSGIETEPTVHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGI
KGKEGSALTEGAKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESS
TVKTETISFGSVSPGGVKLEISTKEVPVVHTETKTITYESSQVDPGTDLEPGVLMSAQTI
TSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQE
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgaatctggatcagactcggaatccaagccggaccaggaggccgagccccag
gaggcggcgggggcgcaggggcgcgcgggggcgcccgtgccggagccgcccaaggaggag
cagcagcaggccctggagcagttcgccgccgctgcagcgcacagcaccccggtgcggagg
gaggtcactgacaaggaacaggagtttgctgccagggctgcaaaacagctcgaatatcag
caattagaagacgataaactttctcagaaatcatctagcagtaaactctctcggtctcca
ttaaagattgtcaaaaagcctaaaagcatgcagtgcaaagtgatacttctcgatggatca
gaatatacctgtgatgtagagaaacgctccagaggacaagtgctgtttgataaagtgtgt
gaacacttgaacttgctagagaaagactactttgggcttacgtatcgagatgctgaaaac
cagaagaattggttggaccctgctaaggaaataaaaaaacaggttcgaagtggtgcttgg
cacttttcatttaatgtgaaattttatccaccagaccctgcccaactatctgaagatatc
accaggtactacctctgcttgcagttgcgagatgacatcgtgtccggaaggctgccctgc
tcctttgttaccctggccttgctgggctcctacactgtccagtcagagctcggagactat
gacccagatgaatgtgggagcgattacattagtgagttccgctttgcaccaaaccacact
aaagaactggaagacaaagtgatcgagctgcacaagagccacagaggaatgacgccagca
gaagcagagatgcatttcttggaaaatgccaaaaaattatcaatgtatggggtagattta
catcatgctaaggactcagaaggggtagaaattatgttaggagtttgtgcaagtggtctg
ttgatatatcgcgaccggctgcgaataaacagatttgcctggcccaaggttctaaagatt
tcatacaaacggaacaacttttacattaagatccggccgggagagtttgaacaatttgaa
agcaccattgggtttaagctgccaaaccatcgagctgccaagcgtttatggaaagtatgt
gttgagcatcatacatttttcagactactgttaccagaagcacctcccaagaaattccta
accttgggttccaagtttcgttatagtggcaggacacaagcgcaaacgagaagagccagt
gcgttgatagatcgcccagcaccttactttgaacgctcatccagcaaacgttataccatg
tctcgcagcttggatggagcatcagtgaatgaaaaccatgaaatatacatgaaggattct
atgtctgctgcagaggttggtactggccagtacgccacaacaaaaggcatctctcagacc
aacttgatcaccactgtgactccggagaagaaggctgaggaggagcgggacgaggaagag
gacaaacggaggaagggggaagaagtcacgcccatctcggccatccggcacgagggaaag
actgacagtgagcgcacggacaccgcagccgacggggagaccactgccactgagtcggac
caggaggaagatgcagagctcaaggcacaggagctagaaaaaactcaagatgacctgatg
aaacatcaaaccaacattagcgagctgaaaagaaccttcttagaaacctcaacagacact
gccgtaacgaatgaatgggagaagaggctttccacctcccccgtgcgactggccgccagg
caggaggatgcccccatgatcgaaccacttgtccctgaagagactaagcagtcttctggg
gaaaagctcatggatggctctgaaatcttcagtttattagagtctgcgcgaaaaccaaca
gaattcataggaggggttacttctacttctcaaagctgggttcagaaaatggaaaccaag
acggagtccagtggaatagagacggaacccaccgtgcaccacctgccgcttagcactgag
aaggtggtgcaggagaccgtgttggtggaggagcggcgtgtggtgcacgcgagtggggat
gcttcttactcggcgggagacagcggggatgctgcagcacagcccgcattcacaggcatt
aaagggaaagagggctctgccttgacggagggggctaaagaggaaggaggggaggaggtc
gctaaagctgtcctggaacaggaagagacagccgctgcttcccgtgagcgacaagaggag
cagagtgcagccatccacatttcagaaactttggaacaaaaacctcattttgagtcctca
acggtgaagacggaaaccatcagttttggcagtgtttcaccgggaggagtaaagctagaa
atttccacgaaggaagtgccagtagttcacaccgaaaccaaaaccatcacatatgaatca
tcacaggtcgatccaggcacagatctggagccaggcgtgctgatgagtgcacagacgatc
acatctgaaaccaccagtaccaccaccactacgcacatcaccaaaactgtgaaagggggc
atttcagagacaagaattgagaagcgaatagtcatcacgggggatgcagacattgaccat
gaccaggaataa

DBGET integrated database retrieval system