KEGG   Homo sapiens (human): 2318Help
Entry
2318              CDS       T01001                                 

Gene name
FLNC, ABP-280, ABP280A, ABPA, ABPL, FLN2, MFM5, MPD4
Definition
(RefSeq) filamin C
  KO
K04437  
filamin
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Disease
H00595  
Myofibrillar myopathies (MFM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    2318 (FLNC)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    2318 (FLNC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    2318 (FLNC)
  Infectious diseases
   05132 Salmonella infection
    2318 (FLNC)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     2318 (FLNC)
  Intermediate filaments
   Intermediate filament-binding proteins
    2318 (FLNC)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2318 (FLNC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
7q32-q35
AA seq 2725 aa AA seqDB search
MMNNSGYSDAGLGLGDETDEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTDL
QRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDSK
AIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPITN
FNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEI
VDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFTV
QTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNIE
RSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGR
RDTVEVALEDKGDSTFRCTYRPAMEGPHTVHVAFAGAPITRSPFPVHVSEACNPNACRAS
GRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYPV
VPGKYVVTITWGGYAIPRSPFEVQVSPEAGVQKVRAWGPGLETGQVGKSADFVVEAIGTE
VGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILP
APPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVIP
NGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGLK
ANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGR
YTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKA
KLDVQFAGTAKGEVVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNV
APPLDLSKIKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGG
AEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGTP
APFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHI
PGSPFKATIRPVFDPSKVRASGPGLERGKVGEAATFTVDCSEAGEAELTIEILSDAGVKA
EVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPGV
EPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYE
EGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAGT
GGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDV
VDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDGT
HTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLPV
EFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDE
IPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTC
TVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPLPH
EEEPSEVPQLRQPYAPPRPGARPTHWATEEPVVPVEPMESMLRPFNLVIPFAVQKGELTG
EVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSR
HVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLP
TAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSQLTAS
IRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGD
ASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTY
CPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKI
PGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPA
VFGDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKVEAAEIVEGEDSAYSVRFVP
QEMGPHTVAVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTR
EAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVP
VASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELD
SDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTT
GVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGP
QHIVGSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVT
RGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKE
KGDYILIVKWGDESVPGSPFKVKVP
NT seq 8178 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaacagcggctactcagacgccggcctcggcctgggcgatgagacagacgag
atgccgtccacggagaaggacctggcggaggacgcgccgtggaagaagatccagcagaac
acattcacgcgctggtgcaatgagcacctcaagtgcgtgggcaagcgcctgaccgacctg
cagcgcgacctcagcgacgggctccggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgtaccgcaagttccatccgcgccccaacttccgccaaatgaagctggagaacgtg
tccgtggccctcgagttcctcgagcgcgagcacatcaagctcgtgtccatagacagcaag
gccatcgtggatgggaacctgaagctgatcctgggcctgatctggacgctgatcctgcac
tactccatctccatgcccatgtgggaggatgaagatgatgaggatgcccgcaaacagacg
cccaagcagcggctgcttggctggatccagaacaaggtgccccagctgcccatcaccaac
ttcaaccgtgactggcaggacggcaaagctctgggcgccctggtggacaactgcgccccc
ggtctctgccccgactgggaggcctgggaccccaaccagcccgtggagaacgcccgggag
gccatgcagcaggccgacgactggcttggggtgccccaggtcattgcccctgaggagatt
gtggaccccaacgtggatgagcattctgttatgacctacctgtcccagttccccaaggcc
aagctcaaacctggtgcccctgttcgatccaagcagctgaaccccaagaaagccatcgcc
tatgggcctggcatcgagccacagggcaacaccgtgctgcagcctgcccacttcaccgtg
cagacggtggacgcgggcgtgggcgaggtgctggtctacatcgaggaccctgaaggccac
accgaggaggctaaggtggttcccaacaatgacaaggatcgcacctatgctgtctcctat
gtgcccaaggtcgctgggttacacaaggtgaccgtgctctttgctggccagaacattgaa
cgcagtccctttgaggtgaacgtgggcatggccctgggagatgccaacaaggtgtcagcc
cgtggccctggcctggaacctgtgggcaatgtggccaacaaacccacctactttgacatc
tacactgcgggggccggcactggcgatgttgctgtggtgatcgtggacccacagggccgg
cgggacacagtggaggtggccctggaggacaagggtgacagcacgttccgctgcacatac
agacctgccatggaggggccacataccgtgcatgtggcctttgcgggtgcccccatcacc
cgcagtcccttccctgtccatgtgtcggaagcctgtaaccccaacgcctgccgcgcctct
gggcgaggcctgcagcccaagggtgttcgcgtgaaagaggtggctgacttcaaggtgttt
accaagggtgccggcagcggggagctcaaggtcacggtcaaggggccaaagggcacagag
gagccagtgaaggtgcgggaggctggggatggtgtgttcgagtgcgagtactacccggtg
gtgcctgggaagtatgtggtgaccatcacgtggggcggctacgccatccctcgcagcccc
tttgaggtacaggtgagcccagaggcaggagtgcaaaaggtccgggcctggggtcctggt
ttggagactggccaggtgggcaagtcagccgattttgtggtggaagccattggcaccgag
gtggggacactgggcttctccatcgaggggccctcacaagccaagatcgaatgtgacgac
aagggggatggctcctgcgatgtgcggtactggcccacggagcctggggagtacgctgtg
cacgtcatctgtgacgatgaggacatccgagactcacccttcattgcccacatcctgccc
gccccacctgactgcttcccagataaggtgaaggcctttgggcctggcctggagcctacc
ggctgcatcgtggacaagcccgctgagttcaccattgatgctcgtgcagctggcaaggga
gacctgaagctctatgcccaggacgccgacggctgtcccatcgacatcaaggtgatcccc
aacggcgacggcaccttccgctgctcctacgtgcccaccaagcccattaagcacaccatc
atcatctcctggggaggcgtaaacgtgcccaagagccccttccgggtgaacgtgggcgag
ggcagccaccccgagcgggtaaaggtgtacggccccggagtggagaagacaggcctcaag
gccaatgagcccacctacttcacggtggactgcagcgaggcggggcaaggcgacgtgagc
atcggcatcaagtgcgccccaggcgtggtgggccctgcagaggctgacattgacttcgac
atcatcaagaatgacaacgacaccttcaccgtcaagtacacgccaccaggggcgggccgc
tacaccatcatggtgctgtttgccaaccaggagatccccgccagccccttccacatcaag
gtggacccatcccacgatgccagcaaagtcaaggccgagggccctgggctgaatcgcaca
ggtgtggaagtcgggaagcccacccacttcacggtgctgaccaagggagccggcaaggcc
aagctggatgtgcagtttgcagggacagccaagggcgaggttgtgcgggactttgagatc
atagacaaccatgactactcctacactgtcaagtacaccgctgtccagcagggcaacatg
gcagtgacagtgacttatggcggggaccctgtccccaagagcccctttgtggtgaatgtg
gcacccccgctggacctcagcaaaatcaaagttcagggccttaatagcaaggtggctgtg
ggacaggaacaagcattctctgtgaacacacgaggggctggcggtcagggccaactggat
gtgcggatgacttcgccctctcgccggcccatcccctgcaagctggagccaggcggtgga
gcggaagcccaggctgtgcgctacatgcccccggaggaggggccctacaaggtggatatc
acctacgatggtcacccggtgcctggcagcccgtttgctgtggagggtgtcctgccccct
gatccctccaaggtctgtgcttatggcccgggtctcaagggtggactggtaggcaccccc
gcgccattctccatcgacaccaagggggctggcacaggtggcctggggctgaccgtagag
ggcccctgcgaggccaagatcgagtgccaggacaatggtgatggctcatgtgctgtcagc
tacctgcccacggagcctggcgagtacaccatcaacatcctgtttgctgaggcccacatc
cctggctcgcccttcaaagccaccattcggcctgtgtttgacccgagcaaggtgcgggcc
agtggaccgggcctggagcgcggcaaggtcggtgaggcagccaccttcactgtggactgc
tcagaggcaggcgaggcggagctgaccattgagatcctgtcggatgccggggtcaaggcc
gaggtgctgatccacaacaacgcggatggcacctaccacatcacctacagccctgccttc
cctggcacctacaccattaccatcaagtatggcgggcatcccgtgcccaaattccccacc
cgtgtccatgtgcagcctgcggtcgataccagtggcgtcaaggtctcagggcctggtgtt
gagccacacggtgtcctgcgggaggtgaccactgagttcactgtggatgcaagatcccta
acagccacaggcggcaaccacgtgacggctcgtgtgctcaacccctcgggggccaagaca
gacacctatgtgacagacaatggggacggcacctaccgagtgcagtacaccgcctacgag
gagggcgtgcatctggtggaggtcctgtatgatgaggtcgctgtgcccaagagccccttc
cgagtgggcgtgaccgagggctgtgatcccacccgcgtccgagccttcgggccaggcctg
gagggtggcttggtcaacaaggccaaccgattcactgtggagaccaggggagcgggcacc
gggggccttggcctagccatcgagggtccctcggaagccaagatgtcctgcaaggacaac
aaggatggtagctgcaccgtggagtacatccccttcactcctggagactatgacgtcaac
atcaccttcggggggcggcccatcccagggagcccgttccgcgtgccagtgaaggatgtg
gtggaccctgggaaggtgaagtgctcagggccagggctgggggctggtgtcagggcccgg
gttcctcagaccttcacagtggactgcagtcaagctggccgggcgcccctgcaggtggct
gtgctgggccccacaggtgtggccgagcctgtggaggtgcgggacaatggagatggcacc
cacactgtccactacaccccagccactgacgggccctacacggtagccgtcaagtatgct
gaccaggaggtgccacgcagccccttcaagatcaaggtcctcccagctcatgatgccagc
aaggtgcgggccagcggcccaggcctcaacgcctctggcatccctgccagcctgcctgtg
gagttcaccatcgacgcacgggacgcgggcgaggggttgctcactgtccagatcttggac
cccgagggtaagcccaagaaggccaacatccgggacaatggggatggcacgtacactgtg
tcctacctgccggacatgagtggccggtacaccatcaccatcaagtatggcggtgatgag
atcccctactcgcccttccgcatccatgctctgcccactggggatgccagcaagtgcctc
gtcacagtgtccattggaggccatggcctgggtgcctgcctgggccctcgaatccagatt
gggcaggagacggtgatcacggtggatgccaaggcagccggtgaggggaaggtgacatgc
acggtgtccacgccggatggggcagagctcgatgtggatgtggttgagaaccatgacggt
acctttgacatctactacacagcgcccgagccgggcaagtacgtcatcaccatccgcttc
gggggtgagcacatccccaacagccccttccacgtgctggcgtgtgaccccctgccgcac
gaggaggagccctctgaagtgccacagctgcgccagccctacgctcctccccggcccggc
gcccgccccacacactgggccacagaggagccagtggtgcctgtggagccaatggagtcc
atgctgaggcccttcaacctggtcatccccttcgcggtgcagaaaggggagctcacagga
gaggtgcggatgccctcggggaagacggcacggcccaacatcaccgacaacaaggacggc
accatcacggtgaggtatgcacccactgagaaaggcctgcaccagatggggatcaagtat
gacggcaaccacatccctgggagccccttacagttctatgtggatgccatcaacagccgc
catgtcagtgcctatgggccaggcctgagccatggcatggtcaacaagccagccaccttc
actattgtcaccaaagatgctggagaagggggtctgtcactggccgtggagggcccatcc
aaggcagagatcacctgtaaggacaacaaggatggcacctgcaccgtgtcctatctgccg
actgcgcctggagactacagcatcatcgtgcgcttcgatgacaagcacatcccggggagc
cccttcacagccaagatcacaggtgatgactccatgaggacctcacagctgaatgtgggc
acctccacggacgtgtcactgaagatcaccgagagtgatctgagccagctgaccgccagc
atccgtgccccctcgggcaacgaggagccctgcctgctgaagcgcctgcccaaccggcac
attgggatctccttcacccccaaggaggtcggggagcacgtggtgagcgtgcgcaagagt
ggcaagcatgtcaccaacagccccttcaagatcctggtggggccatctgagatcggggac
gccagcaaggtgcgggtctggggcaaggggctttccgagggacacacattccaggtggca
gagttcatcgtggacactcgcaatgcaggttatgggggcttggggctgagtattgaaggc
ccaagcaaggtggacatcaactgtgaggacatggaggacgggacatgcaaagtcacctac
tgccccaccgagcccggcacctacatcatcaacatcaagtttgctgacaagcacgtgcct
ggaagccccttcactgtgaaggtgaccggcgagggccgcatgaaggagagcatcacccgg
cggagacaggcaccttccatcgccaccatcggcagcacctgtgacctcaacctcaagatc
ccaggaaactggttccagatggtgtctgcccaggagcgcctgacacgcaccttcacacgc
agcagccacacctacacccgcacggagcgcacggagatcagcaagacgcggggcggggag
acaaagcgcgaggtgcgggtggaggagtccacccaggtcggcggggaccccttccctgct
gtgtttggggacttcctgggccgggagcgcctgggatccttcggcagcatcacccggcag
caggagggtgaggccagctctcaggacatgactgcacaggtgaccagcccatcgggcaag
gtggaagccgcagagatcgtcgagggcgaggacagcgcctacagcgtgcgctttgtgccc
caggaaatggggccccatacggtcgctgtcaagtaccgtggccagcacgtgcccggcagc
ccctttcagttcactgtggggccgctgggtgaaggtggtgcccacaaggtgcgggccgga
ggcacagggctggagcgaggtgtggccggcgtgccagccgagttcagcatctggacccgg
gaggctggcgctgggggcctgtccattgctgtggagggtcctagcaaagcggagattgca
tttgaggatcgcaaagatggctcctgcggcgtctcctatgtcgtccaggaaccaggtgac
tatgaggtctccatcaagttcaatgatgagcacatcccagacagcccctttgtggtgcct
gtggcctccctctcggatgacgctcgccgtctcactgtcaccagcctccaggagacgggg
ctcaaggtgaaccagccagcgtcctttgccgtgcagctgaacggtgcccggggcgtgatt
gatgcccgggtgcacacaccctcgggggctgtggaggagtgctacgtctctgagctggac
agtgacaagcacaccatccgcttcatcccccacgagaatggcgtccactccatcgatgtc
aagttcaacggtgcccacatccctggaagtcccttcaagatccgcgttggggagcagagc
caggctggggacccaggcttggtgtcagcctacggtcctgggctcgagggaggcactacc
ggtgtgtcatcagagttcatcgtgaacaccctgaatgccggctcgggggccttgtctgtc
accattgatggcccctccaaggtgcagctggactgtcgggagtgtcctgagggccatgtg
gtcacttatactcccatggcccctggcaactacctcattgccatcaagtacggtggcccc
cagcacatcgtgggcagccccttcaaggccaaggtcactggtccgaggctgtccggaggc
cacagccttcacgaaacatccacggttctggtggagactgtgaccaagtcctcctcaagc
cggggctccagctacagctccatccccaagttctcctcagatgccagcaaggtggtgact
cggggccctgggctgtcccaggccttcgtgggccagaagaactccttcaccgtggactgc
agcaaagcaggcaccaacatgatgatggtgggcgtgcacggccccaagaccccctgtgag
gaggtgtacgtgaagcacatggggaaccgggtgtacaatgtcacctacactgtcaaggag
aaaggggactacatcctcattgtcaagtggggtgacgaaagtgtccctggaagccccttc
aaagtcaaggtcccttga

DBGET integrated database retrieval system