KEGG   Homo sapiens (human): 23308Help
Entry
23308             CDS       T01001                                 

Gene name
ICOSLG, B7-H2, B7H2, B7RP-1, B7RP1, CD275, GL50, ICOS-L, ICOSL, LICOS
Definition
inducible T-cell co-stimulator ligand
Orthology
K06710  
inducible T-cell co-stimulator ligand
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    23308 (ICOSLG)
 Organismal Systems
  Immune system
   04672 Intestinal immune network for IgA production
    23308 (ICOSLG)
Cellular antigens [BR:hsa04090]
 Proteins
  23308 (ICOSLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
21q22.3
AA seq 309 aa AA seqDB search
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESK
TVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSL
GFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLL
DQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERD
KITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTE
SWNLLLLLS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgggcagtcctggactgctcttcctgctcttcagcagccttcgagctgatact
caggagaaggaagtcagagcgatggtaggcagcgacgtggagctcagctgcgcttgccct
gaaggaagccgttttgatttaaatgatgtttacgtatattggcaaaccagtgagtcgaaa
accgtggtgacctaccacatcccacagaacagctccttggaaaacgtggacagccgctac
cggaaccgagccctgatgtcaccggccggcatgctgcggggcgacttctccctgcgcttg
ttcaacgtcaccccccaggacgagcagaagtttcactgcctggtgttgagccaatccctg
ggattccaggaggttttgagcgttgaggttacactgcatgtggcagcaaacttcagcgtg
cccgtcgtcagcgccccccacagcccctcccaggatgagctcaccttcacgtgtacatcc
ataaacggctaccccaggcccaacgtgtactggatcaataagacggacaacagcctgctg
gaccaggctctgcagaatgacaccgtcttcttgaacatgcggggcttgtatgacgtggtc
agcgtgctgaggatcgcacggacccccagcgtgaacattggctgctgcatagagaacgtg
cttctgcagcagaacctgactgtcggcagccagacaggaaatgacatcggagagagagac
aagatcacagagaatccagtcagtaccggcgagaaaaacgcggccacgtggagcatcctg
gctgtcctgtgcctgcttgtggtcgtggcggtggccataggctgggtgtgcagggaccga
tgcctccaacacagctatgcaggtgcctgggctgtgagtccggagacagagctcactgaa
tcctggaacctgctccttctgctctcgtga

DBGET integrated database retrieval system