KEGG   Homo sapiens (human): 23308Help
Entry
23308             CDS       T01001                                 

Gene name
ICOSLG, B7-H2, B7H2, B7RP-1, B7RP1, CD275, GL50, ICOS-L, ICOSL, LICOS
Definition
(RefSeq) inducible T-cell co-stimulator ligand
  KO
K06710  
inducible T-cell co-stimulator ligand
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    23308 (ICOSLG)
 Organismal Systems
  Immune system
   04672 Intestinal immune network for IgA production
    23308 (ICOSLG)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   B7-CD28 family
    CD28; CD28 antigen [KO:K06470]
     23308 (ICOSLG)
    CTLA4, CD152; cytotoxic T-lymphocyte-associated protein 4 [KO:K06538]
     23308 (ICOSLG)
    ICOS, AILIM; inducible T-cell co-stimulator [KO:K06713]
     23308 (ICOSLG)
Cellular antigens [BR:hsa04090]
 Proteins
  23308 (ICOSLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
21q22.3
AA seq 302 aa AA seqDB search
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESK
TVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSL
GFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLL
DQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERD
KITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTG
HV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgggcagtcctggactgctcttcctgctcttcagcagccttcgagctgatact
caggagaaggaagtcagagcgatggtaggcagcgacgtggagctcagctgcgcttgccct
gaaggaagccgttttgatttaaatgatgtttacgtatattggcaaaccagtgagtcgaaa
accgtggtgacctaccacatcccacagaacagctccttggaaaacgtggacagccgctac
cggaaccgagccctgatgtcaccggccggcatgctgcggggcgacttctccctgcgcttg
ttcaacgtcaccccccaggacgagcagaagtttcactgcctggtgttgagccaatccctg
ggattccaggaggttttgagcgttgaggttacactgcatgtggcagcaaacttcagcgtg
cccgtcgtcagcgccccccacagcccctcccaggatgagctcaccttcacgtgtacatcc
ataaacggctaccccaggcccaacgtgtactggatcaataagacggacaacagcctgctg
gaccaggctctgcagaatgacaccgtcttcttgaacatgcggggcttgtatgacgtggtc
agcgtgctgaggatcgcacggacccccagcgtgaacattggctgctgcatagagaacgtg
cttctgcagcagaacctgactgtcggcagccagacaggaaatgacatcggagagagagac
aagatcacagagaatccagtcagtaccggcgagaaaaacgcggccacgtggagcatcctg
gctgtcctgtgcctgcttgtggtcgtggcggtggccataggctgggtgtgcagggaccga
tgcctccaacacagctatgcaggtgcctgggctgtgagtccggagacagagctcactggc
cacgtttga

DBGET integrated database retrieval system