KEGG   Homo sapiens (human): 23418Help
Entry
23418             CDS       T01001                                 

Gene name
CRB1, LCA8, RP12
Definition
crumbs family member 1, photoreceptor morphogenesis associated
Orthology
K16681  
protein crumbs
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
Disease
H00527  
Retinitis pigmentosa (RP)
H00837  
Leber congenital amaurosis (LCR)
H01088  
Pigmented paravenous chorioretinal atrophy (PPCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    23418 (CRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
1q31-q32.1
AA seq 1294 aa AA seqDB search
MALKNINYLLIFYLSFSLLIYIKNSFCNKNNTRCLSNSCQNNSTCKDFSKDNDCSCSDTA
NNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQ
HGGICHQDPIYPVCICPAGYAGRFCEIDHDECASSPCQNGAVCQDGIDGYSCFCVPGYQG
RHCDLEVDECASDPCKNEATCLNEIGRYTCICPHNYSGYTGAQCEIDLNECNSNPCQSNG
ECVELSSEKQYGRITGLPSSFSYHEASGYVCICQPGFTGIHCEEDVNECSSNPCQNGGTC
ENLPGNYTCHCPFDNLSRTFYGGRDCSDILLGCTHQQCLNNGTCIPHFQDGQHGFSCLCP
SGYTGSLCEIATTLSFEGDGFLWVKSGSVTTKGSVCNIALRFQTVQPMALLLFRSNRDVF
VKLELLSGYIHLSIQVNNQSKVLLFISHNTSDGEWHFVEVIFAEAVTLTLIDDSCKEKCI
AKAPTPLESDQSICAFQNSFLGGLPVGMTSNGVALLNFYNMPSTPSFVGCLQDIKIDWNH
ITLENISSGSSLNVKAGCVRKDWCESQPCQSRGRCINLWLSYQCDCHRPYEGPNCLREYV
AGRFGQDDSTGYVIFTLDESYGDTISLSMFVRTLQPSGLLLALENSTYQYIRVWLERGRL
AMLTPNSPKLVVKFVLNDGNVHLISLKIKPYKIELYQSSQNLGFISASTWKIEKGDVIYI
GGLPDKQETELNGGFFKGCIQDVRLNNQNLEFFPNPTNNASLNPVLVNVTQGCAGDNSCK
SNPCHNGGVCHSRWDDFSCSCPALTSGKACEEVQWCGFSPCPHGAQCQPVLQGFECIANA
VFNGQSGQILFRSNGNITRELTNITFGFRTRDANVIILHAEKEPEFLNISIQDSRLFFQL
QSGNSFYMLSLTSLQSVNDGTWHEVTLSMTDPLSQTSRWQMEVDNETPFVTSTIATGSLN
FLKDNTDIYVGDRAIDNIKGLQGCLSTIEIGGIYLSYFENVHGFINKPQEEQFLKISTNS
VVTGCLQLNVCNSNPCLHGGNCEDIYSSYHCSCPLGWSGKHCELNIDECFSNPCIHGNCS
DRVAAYHCTCEPGYTGVNCEVDIDNCQSHQCANGATCISHTNGYSCLCFGNFTGKFCRQS
RLPSTVCGNEKTNLTCYNGGNCTEFQTELKCMCRPGFTGEWCEKDIDECASDPCVNGGLC
QDLLNKFQCLCDVAFAGERCEVDLADDLISDIFTTIGSVTVALLLILLLAIVASVVTSNK
RATQGTYSPSRQEKEGSRVEMWNLMPPPAMERLI
NT seq 3885 nt NT seq  +upstreamnt  +downstreamnt
atggcacttaagaacattaactaccttctcatcttctacctcagtttctcactgcttatc
tacataaaaaattccttttgcaataaaaacaacaccaggtgcctctcaaattcttgccaa
aacaattctacatgcaaagatttttcaaaagacaatgattgttcttgttcagacacagcc
aataatttggacaaagactgtgacaacatgaaagacccttgcttctccaatccctgtcaa
ggaagtgccacttgtgtgaacaccccaggagaaaggagctttctgtgcaaatgtcctcct
gggtacagtgggacaatctgtgaaactaccattggttcctgtggcaagaactcctgccaa
catggaggtatttgccatcaggaccctatttatcctgtctgcatctgccctgctggatat
gctggaagattctgtgagatagatcacgatgagtgtgcttccagcccttgccaaaatggg
gccgtgtgccaggatggaattgatggttactcctgcttctgtgtcccaggatatcaaggc
agacactgcgacttggaagtggatgaatgtgcttcagatccctgcaagaacgaggctaca
tgcctcaatgaaataggaagatatacttgtatctgtccccacaattattctggatacaca
ggtgcccagtgtgagatcgacctcaatgaatgcaatagtaacccctgccagtccaatggg
gaatgtgtggagctgtcctcagagaaacaatatggacgcatcactggactgccttcttct
ttcagctaccatgaagcctcaggttatgtctgtatctgtcagcctggattcacaggaatc
cactgcgaagaagacgtcaatgaatgttcttcaaacccttgccaaaatggtggtacttgt
gagaacttgcctgggaattatacttgccattgcccatttgataacctttctagaactttt
tatggaggaagggactgttctgatattctcctgggctgtacccatcagcaatgtctaaat
aatggaacatgcatccctcacttccaagatggccagcatggattcagctgcctgtgtcca
tctggctacaccgggtccctgtgtgaaatcgcaaccacactttcatttgagggcgatggc
ttcctgtgggtcaaaagtggctcagtgacaaccaagggctcagtttgtaacatagccctc
aggtttcagactgttcagccaatggctcttctacttttccgaagcaacagggatgtgttt
gtgaagctggagctgctaagtggctacattcacttatcaattcaggtcaataatcagtca
aaggtgcttctgttcatttcccacaacaccagcgatggagagtggcatttcgtggaggta
atatttgcagaggctgtgacccttaccttaatcgacgactcctgtaaggagaaatgcatc
gcgaaagctcctactccacttgaaagtgatcaatcaatatgtgcttttcagaactccttt
ttgggtggtttaccagtgggaatgaccagcaatggtgttgctctgcttaacttctataat
atgccatccacaccttcgtttgtaggctgtctccaagacattaaaattgattggaatcac
attaccctggagaacatctcgtctggctcatcattaaatgtcaaggcaggctgtgtgaga
aaggattggtgtgaaagccaaccttgtcaaagcagaggacgctgcatcaacttgtggctg
agttaccagtgtgactgccacaggccctatgaaggccccaactgtctgagagagtatgtg
gcaggcagatttggccaggatgactccactggttatgtcatctttactcttgatgagagc
tatggagacaccatcagcctctccatgtttgtccgaacgcttcaaccatcaggcttactt
ctagctttggaaaacagcacttatcaatatatccgtgtctggctagagcgcggcagacta
gcaatgctgactccaaactctcccaaattagtagtaaaatttgttcttaatgatggaaat
gtccacttgatatctttgaaaatcaagccatataaaattgaactgtatcagtcttcacaa
aacctaggatttatttctgcttctacgtggaaaatcgaaaagggagatgtcatctacatt
ggtggcctacctgacaagcaagagactgaacttaatggtggattcttcaaaggctgtatc
caagatgtaagactaaacaaccaaaatctggaattctttccaaatccaacaaacaatgca
tctctcaatccagttcttgtcaatgtaacccaaggctgtgctggagacaacagctgcaag
tccaacccctgtcacaatggaggtgtttgccattcccggtgggatgacttctcctgttcc
tgtcctgccctcacaagtgggaaagcctgtgaggaggttcagtggtgtggattcagcccg
tgtcctcacggagcccagtgccagccggtgcttcaaggatttgaatgtattgcaaatgct
gtttttaatggacaaagcggtcaaatattattcagaagcaatgggaatattaccagagaa
ctcaccaatatcacatttggtttcagaacaagggatgcaaatgtaataatattgcatgca
gaaaaagagcctgaatttcttaatattagcattcaagattccagattattctttcaattg
caaagtggcaacagcttttatatgctaagtctgacaagtttgcagtcagtgaatgatggc
acatggcacgaagtgaccctttccatgacagacccactgtcccagacctccaggtggcaa
atggaagtggacaacgaaacaccttttgtgaccagcacaattgctactggaagcctcaac
tttttgaaggataatacagatatttatgtgggagacagagctattgacaatataaagggc
ctgcaagggtgtctaagtacaatagaaatcggaggcatttatctctcttactttgaaaat
gttcatggtttcattaataaacctcaggaagagcaatttctcaaaatctctaccaattca
gtggtcactggctgtttgcagttaaatgtctgcaactccaacccctgtttgcatggagga
aactgtgaagacatctatagctcttatcattgctcctgtcccttgggatggtcagggaaa
cactgtgaactcaacatcgatgaatgcttttcaaacccctgtatccatggcaactgctct
gacagagttgcagcctaccactgcacatgtgagcctggatacactggtgtgaactgtgaa
gtggatatagacaactgccagagtcaccagtgtgcaaatggagccacctgcattagtcat
actaatggctattcttgcctctgttttggaaattttacaggaaaattttgcagacagagc
agattaccctcaacagtctgtgggaatgagaagacaaatctcacttgctacaatggaggc
aactgcacagagttccagactgaattaaaatgtatgtgccggccaggttttactggagaa
tggtgtgaaaaggacattgatgagtgtgcctctgatccgtgtgtcaatggaggtctgtgc
caggacttactcaacaaattccagtgcctctgtgatgttgcctttgctggcgagcgctgc
gaggtggacttggcagatgacttgatctccgacattttcaccactattggctcagtgact
gtcgccttgttactgatcctcttgctggccattgttgcttctgttgtcacctccaacaaa
agggcaactcagggaacctacagccccagccgtcaggagaaggagggctcccgagtggaa
atgtggaacttgatgccaccccctgcaatggagagactgatttag

DBGET integrated database retrieval system