KEGG   Homo sapiens (human): 2521Help
Entry
2521              CDS       T01001                                 

Gene name
FUS, ALS6, ETM4, FUS1, HNRNPP2, POMP75, TLS
Definition
FUS RNA binding protein
Orthology
K13098  
RNA-binding protein FUS
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Disease
H00049  
Myxoid liposarcoma
H00058  
Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    2521 (FUS)
Spliceosome [BR:hsa03041]
 Complex A
  Other components
   Complex A specific factors
    2521 (FUS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
16p11.2
AA seq 525 aa AA seqDB search
MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQ
SQNSYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSS
YGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQ
SSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEP
RGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESV
ADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSG
NPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQ
RAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDR
GGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaaacgattatacccaacaagcaacccaaagctatggggcctaccccacccag
cccgggcagggctattcccagcagagcagtcagccctacggacagcagagttacagtggt
tatagccagtccacggacacttcaggctatggccagagcagctattcttcttatggccag
agccagaacagctatggaactcagtcaactccccagggatatggctcgactggcggctat
ggcagtagccagagctcccaatcgtcttacgggcagcagtcctcctaccctggctatggc
cagcagccagctcccagcagcacctcgggaagttacggtagcagttctcagagcagcagc
tatgggcagccccagagtgggagctacagccagcagcctagctatggtggacagcagcaa
agctatggacagcagcaaagctataatccccctcagggctatggacagcagaaccagtac
aacagcagcagtggtggtggaggtggaggtggaggtggaggtaactatggccaagatcaa
tcctccatgagtagtggtggtggcagtggtggcggttatggcaatcaagaccagagtggt
ggaggtggcagcggtggctatggacagcaggaccgtggaggccgcggcaggggtggcagt
ggtggcggcggcggcggcggcggtggtggttacaaccgcagcagtggtggctatgaaccc
agaggtcgtggaggtggccgtggaggcagaggtggcatgggcggaagtgaccgtggtggc
ttcaataaatttggtggccctcgggaccaaggatcacgtcatgactccgaacaggataat
tcagacaacaacaccatctttgtgcaaggcctgggtgagaatgttacaattgagtctgtg
gctgattacttcaagcagattggtattattaagacaaacaagaaaacgggacagcccatg
attaatttgtacacagacagggaaactggcaagctgaagggagaggcaacggtctctttt
gatgacccaccttcagctaaagcagctattgactggtttgatggtaaagaattctccgga
aatcctatcaaggtctcatttgctactcgccgggcagactttaatcggggtggtggcaat
ggtcgtggaggccgagggcgaggaggacccatgggccgtggaggctatggaggtggtggc
agtggtggtggtggccgaggaggatttcccagtggaggtggtggcggtggaggacagcag
cgagctggtgactggaagtgtcctaatcccacctgtgagaatatgaacttctcttggagg
aatgaatgcaaccagtgtaaggcccctaaaccagatggcccaggagggggaccaggtggc
tctcacatggggggtaactacggggatgatcgtcgtggtggcagaggaggctatgatcga
ggcggctaccggggccgcggcggggaccgtggaggcttccgagggggccggggtggtggg
gacagaggtggctttggccctggcaagatggattccaggggtgagcacagacaggatcgc
agggagaggccgtattaa

DBGET integrated database retrieval system