KEGG   Homo sapiens (human): 2542Help
Entry
2542              CDS       T01001                                 

Gene name
SLC37A4, G6PT1, G6PT2, G6PT3, GSD1b, GSD1c, GSD1d, TRG-19, TRG19
Definition
solute carrier family 37 (glucose-6-phosphate transporter), member 4
Orthology
K08171  
MFS transporter, OPA family, solute carrier family 37 (glycerol-6-phosphate transporter), member 4
Organism
hsa  Homo sapiens (human)
Pathway
Carbohydrate digestion and absorption
Disease
H00069  
Glycogen storage diseases (GSD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    2542 (SLC37A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
11q23.3
AA seq 429 aa AA seqDB search
MAAQGYGYYRTVIFSAMFGGYSLYYFNRKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAY
AISKFVSGVLSDQMSARWLFSSGLLLVGLVNIFFAWSSTVPVFAALWFLNGLAQGLGWPP
CGKVLRKWFEPSQFGTWWAILSTSMNLAGGLGPILATILAQSYSWRSTLALSGALCVVVS
FLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWVLSTGYLVVFGVK
TCCTDWGQFFLIQEKGQSALVGSSYMSALEVGGLVGSIAAGYLSDRAMAKAGLSNYGNPR
HGLLLFMMAGMTVSMYLFRVTVTSDSPKLWILVLGAVFGFSSYGPIALFGVIANESAPPN
LCGTSHAIVGLMANVGGFLAGLPFSTIAKHYSWSTAFWVAEVICAASTAAFFLLRNIRTK
MGRVSKKAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccagggctatggctattatcgcactgtgatcttctcagccatgtttgggggc
tacagcctgtattacttcaatcgcaagaccttctcctttgtcatgccatcattggtggaa
gagatccctttggacaaggatgatttggggttcatcaccagcagccagtcggcagcttat
gctatcagcaagtttgtcagtggggtgctgtctgaccagatgagtgctcgctggctcttc
tcttctgggctgctcctggttggcctggtcaacatattctttgcctggagctccacagta
cctgtctttgctgccctctggttccttaatggcctggcccaggggctgggctggccccca
tgtgggaaggtcctgcggaagtggtttgagccatctcagtttggcacttggtgggccatc
ctgtcaaccagcatgaacctggctggagggctgggccctatcctggcaaccatccttgcc
cagagctacagctggcgcagcacgctggccctatctggggcactgtgtgtggttgtctcc
ttcctctgtctcctgctcatccacaatgaacctgctgatgttggactccgcaacctggac
cccatgccctctgagggcaagaagggctccttgaaggaggagagcaccctgcaggagctg
ctgctgtccccttacctgtgggtgctctccactggttaccttgtggtgtttggagtaaag
acctgctgtactgactggggccagttcttccttatccaggagaaaggacagtcagccctt
gtaggtagctcctacatgagtgccctggaagttgggggccttgtaggcagcatcgcagct
ggctacctgtcagaccgggccatggcaaaggcgggactgtccaactacgggaaccctcgc
catggcctgttgctgttcatgatggctggcatgacagtgtccatgtacctcttccgggta
acagtgaccagtgactcccccaagctctggatcctggtattgggagctgtatttggtttc
tcctcgtatggccccattgccctgtttggagtcatagccaacgagagtgcccctcccaac
ttgtgtggcacctcccacgccattgtgggactcatggccaatgtgggcggctttctggct
gggctgcccttcagcaccattgccaagcactacagttggagcacagccttctgggtggct
gaagtgatttgtgcggccagcacggctgccttcttcctcctacgaaacatccgcaccaag
atgggccgagtgtccaagaaggctgagtga

DBGET integrated database retrieval system