KEGG   Homo sapiens (human): 25833Help
Entry
25833             CDS       T01001                                 

Gene name
POU2F3, Epoc-1, OCT-11, OCT11, OTF-11, PLA-1, PLA1, Skn-1a
Definition
POU class 2 homeobox 3
Orthology
K09364  
POU domain transcription factor, class 2
Organism
hsa  Homo sapiens (human)
Pathway
Herpes simplex infection
Class
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
11q23.3
AA seq 438 aa AA seqDB search
MESPRTAKGGRDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTL
SHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQPG
QQGLQPNLLPFPQQQSGLLLPQTGPGLASQAFGHPGLPGSSLEPHLEASQHLPVPKHLPS
SGGADEPSDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLS
FKNMCKLKPLLEKWLNDAESSPSDPSVSTPSSYPSLSEVFGRKRKKRTSIETNIRLTLEK
RFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPIKPPVYNSRLVS
PSGSLGPLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVNSAS
SFNSSGSWYRWNHSTYLH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggagtctccaagaactgctaaaggaggaagggatatcaagatgagtggggatgtagcc
gattccacggatgctcgcagcactctcagccaggtggagccaggaaatgatcgaaatggc
ctagatttcaacaggcagattaaaaccgaagatctcagtgactccctgcagcagaccctc
tcccatcggccatgccacctgagtcaaggacctgccatgatgtccggaaaccaaatgtct
gggctaaatgccagcccatgtcaggacatggcttccctccatccgctccagcagcttgtg
ctggttcccggccacttacagtctgtatcccagttcctgctatctcagacccagcctggg
cagcaaggtctgcagccaaatctcctcccctttccacagcaacaaagcggtctcctcctc
ccacagactgggccgggactggcatcccaggcatttgggcaccctgggctgccaggatcc
tctttagaaccccacctggaagcatcccagcatctcccagtgcccaagcatctacccagc
tctggaggggccgatgagcccagtgacctcgaggagctggagaagtttgccaagaccttc
aagcagaggcgcattaagctgggcttcacacagggagatgtggggctggcgatgggaaag
ctgtatggcaacgacttcagccagaccaccatctcacgatttgaggccctcaacctgagc
ttcaagaacatgtgcaagctcaagcccctgctggagaagtggctgaatgatgcagagtcc
tctccgtcagacccctcagtgagcacgcccagctcctaccccagcctcagtgaagtattt
ggtaggaagagaaagaaacggaccagcatcgagaccaacatccgcctgactctggagaag
aggtttcaagataacccaaaacccagctcggaggagatctccatgattgcagagcagttg
tccatggagaaggaggtggtgagggtctggttctgcaaccgacgccaaaaggagaagcga
atcaactgccctgtggccacacccatcaaaccacctgtctacaactcccggctggtatct
ccctcagggtctctgggccccctctctgtccctcctgtccacagtaccatgcctggaaca
gtaacgtcatcctgttcccctgggaacaacagcaggccttcatctcctggctcaggactc
cacgccagcagccccactgcatctcaaaataactccaaagcagcagtgaactccgcctcc
agttttaactcttcaggatcttggtaccgatggaatcattccacctacctccactga

DBGET integrated database retrieval system