KEGG   Homo sapiens (human): 25833Help
Entry
25833             CDS       T01001                                 

Gene name
POU2F3, Epoc-1, OCT-11, OCT11, OTF-11, PLA-1, PLA1, Skn-1a
Definition
(RefSeq) POU class 2 homeobox 3
  KO
K09364  
POU domain transcription factor, class 2
Organism
hsa  Homo sapiens (human)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    25833 (POU2F3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   POU domain factors
    25833 (POU2F3)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   Other transcription-related factors
    Octamer transcription factors
     25833 (POU2F3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
11q23.3
AA seq 436 aa AA seqDB search
MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSH
RPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQPGQQ
GLQPNLLPFPQQQSGLLLPQTGPGLASQAFGHPGLPGSSLEPHLEASQHLPVPKHLPSSG
GADEPSDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFK
NMCKLKPLLEKWLNDAESSPSDPSVSTPSSYPSLSEVFGRKRKKRTSIETNIRLTLEKRF
QDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPIKPPVYNSRLVSPS
GSLGPLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVNSASSF
NSSGSWYRWNHSTYLH
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatctggagtccatgcacacagatatcaagatgagtggggatgtagccgattcc
acggatgctcgcagcactctcagccaggtggagccaggaaatgatcgaaatggcctagat
ttcaacaggcagattaaaaccgaagatctcagtgactccctgcagcagaccctctcccat
cggccatgccacctgagtcaaggacctgccatgatgtccggaaaccaaatgtctgggcta
aatgccagcccatgtcaggacatggcttccctccatccgctccagcagcttgtgctggtt
cccggccacttacagtctgtatcccagttcctgctatctcagacccagcctgggcagcaa
ggtctgcagccaaatctcctcccctttccacagcaacaaagcggtctcctcctcccacag
actgggccgggactggcatcccaggcatttgggcaccctgggctgccaggatcctcttta
gaaccccacctggaagcatcccagcatctcccagtgcccaagcatctacccagctctgga
ggggccgatgagcccagtgacctcgaggagctggagaagtttgccaagaccttcaagcag
aggcgcattaagctgggcttcacacagggagatgtggggctggcgatgggaaagctgtat
ggcaacgacttcagccagaccaccatctcacgatttgaggccctcaacctgagcttcaag
aacatgtgcaagctcaagcccctgctggagaagtggctgaatgatgcagagtcctctccg
tcagacccctcagtgagcacgcccagctcctaccccagcctcagtgaagtatttggtagg
aagagaaagaaacggaccagcatcgagaccaacatccgcctgactctggagaagaggttt
caagataacccaaaacccagctcggaggagatctccatgattgcagagcagttgtccatg
gagaaggaggtggtgagggtctggttctgcaaccgacgccaaaaggagaagcgaatcaac
tgccctgtggccacacccatcaaaccacctgtctacaactcccggctggtatctccctca
gggtctctgggccccctctctgtccctcctgtccacagtaccatgcctggaacagtaacg
tcatcctgttcccctgggaacaacagcaggccttcatctcctggctcaggactccacgcc
agcagccccactgcatctcaaaataactccaaagcagcagtgaactccgcctccagtttt
aactcttcaggatcttggtaccgatggaatcattccacctacctccactga

DBGET integrated database retrieval system