KEGG   Homo sapiens (human): 2585Help
Entry
2585              CDS       T01001                                 

Gene name
GALK2, GK2
Definition
galactokinase 2 (EC:2.7.1.157)
Orthology
K00849  
galactokinase [EC:2.7.1.6]
Organism
hsa  Homo sapiens (human)
Pathway
Galactose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, galactose => UDP-galactose
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hsa00052]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hsa00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
15q21.1-q21.2
AA seq 447 aa AA seqDB search
MPVLYDRLLKLKEMFNSKFGSIPKFYVRAPGRVNIIGEHIDYCGYSVLPMAVEQDVLIAV
EPVKTYALQLANTNPLYPDFSTSANNIQIDKTKPLWHNYFLCGLKGIQEHFGLSNLTGMN
CLVDGNIPPSSGLSSSSALVCCAGLVTLTVLGRNLSKVELAEICAKSERYIGTEGGGMDQ
SISFLAEEGTAKLIEFSPLRATDVKLPSGAVFVIANSCVEMNKAATSHFNIRVMECRLAA
KLLAKYKSLQWDKVLRLEEVQAKLGISLEEMLLVTEDALHPEPYNPEEICRCLGISLEEL
RTQILSPNTQDVLIFKLYQRAKHVYSEAARVLQFKKICEEAPENMVQLLGELMNQSHMSC
RDMYECSCPELDQLVDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSFLANVHKAYYQR
SDGSLAPEKQSLFATKPGGGALVLLEA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcctatatgacaggttactgaagctaaaggagatgtttaactccaagtttgga
tctattcccaagttttatgttcgagcaccaggaagagtcaacataataggagagcatata
gattattgtggatattctgttcttcctatggctgtagaacaagatgtgctaatagctgta
gaacctgtgaaaacgtacgctctccaactggccaatacaaatcccttgtatccggacttc
agtactagtgctaataacatccagattgataaaaccaagcctttgtggcacaactatttc
ttatgtggacttaaaggaattcaggaacactttggtcttagtaacctgactggaatgaac
tgcctggtagatggaaatatcccaccaagttctggcctctccagctccagtgctttggtc
tgttgtgctggcttggtgacgctcacagtgctgggaaggaatctatccaaggtggaactt
gcagaaatctgtgccaagagtgagcgttacattggcactgaaggaggaggcatggaccag
tctatatcatttcttgcagaagaaggaactgccaagttgatagaatttagtcctctgagg
gcaaccgatgtaaaactcccaagtggagcagtgtttgtgattgccaacagttgtgtggag
atgaataaggcagcaacttcccatttcaatatcagggtgatggagtgtcggctggctgcg
aagctcctggctaaatacaaaagcttgcaatgggacaaagtactgaggctggaggaggtg
caggctaaactagggattagtctagaagaaatgctgttggtcacagaagatgcccttcat
cctgaaccctataaccctgaggagatctgcaggtgtctgggaattagcctggaggaactc
cgaacccaaatcctgagtccaaacactcaagatgtgctcatcttcaaactctatcagcgg
gcaaagcatgtgtacagcgaggctgcgcgagtgctccagtttaagaagatatgtgaagaa
gcacctgaaaacatggtccagctgctgggagagttgatgaaccagagccacatgagctgc
cgggacatgtatgagtgcagctgccccgagctggatcagctggtggacatctgtcggaag
tttggggctcaagggtcacgacttactggagcaggatggggaggctgcacagtatcaatg
gtacctgcggacaagctgcccagctttctagcaaatgtgcacaaagcttattaccagagg
agtgatggaagcttagcaccggagaagcaaagtttgtttgctaccaaacctggaggtggg
gctttggttttgcttgaggcctga

DBGET integrated database retrieval system