KEGG   Homo sapiens (human): 2585Help
Entry
2585              CDS       T01001                                 

Gene name
GALK2, GK2
Definition
galactokinase 2 (EC:2.7.1.157)
Orthology
K18674  
N-acetylgalactosamine kinase [EC:2.7.1.157]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.157  N-acetylgalactosamine kinase
     2585 (GALK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
15q21.1-q21.2
AA seq 447 aa AA seqDB search
MPVLYDRLLKLKEMFNSKFGSIPKFYVRAPGRVNIIGEHIDYCGYSVLPMAVEQDVLIAV
EPVKTYALQLANTNPLYPDFSTSANNIQIDKTKPLWHNYFLCGLKGIQEHFGLSNLTGMN
CLVDGNIPPSSGLSSSSALVCCAGLVTLTVLGRNLSKVELAEICAKSERYIGTEGGGMDQ
SISFLAEEGTAKLIEFSPLRATDVKLPSGAVFVIANSCVEMNKAATSHFNIRVMECRLAA
KLLAKYKSLQWDKVLRLEEVQAKLGISLEEMLLVTEDALHPEPYNPEEICRCLGISLEEL
RTQILSPNTQDVLIFKLYQRAKHVYSEAARVLQFKKICEEAPENMVQLLGELMNQSHMSC
RDMYECSCPELDQLVDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSFLANVHKAYYQR
SDGSLAPEKQSLFATKPGGGALVLLEA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcctatatgacaggttactgaagctaaaggagatgtttaactccaagtttgga
tctattcccaagttttatgttcgagcaccaggaagagtcaacataataggagagcatata
gattattgtggatattctgttcttcctatggctgtagaacaagatgtgctaatagctgta
gaacctgtgaaaacgtacgctctccaactggccaatacaaatcccttgtatccggacttc
agtactagtgctaataacatccagattgataaaaccaagcctttgtggcacaactatttc
ttatgtggacttaaaggaattcaggaacactttggtcttagtaacctgactggaatgaac
tgcctggtagatggaaatatcccaccaagttctggcctctccagctccagtgctttggtc
tgttgtgctggcttggtgacgctcacagtgctgggaaggaatctatccaaggtggaactt
gcagaaatctgtgccaagagtgagcgttacattggcactgaaggaggaggcatggaccag
tctatatcatttcttgcagaagaaggaactgccaagttgatagaatttagtcctctgagg
gcaaccgatgtaaaactcccaagtggagcagtgtttgtgattgccaacagttgtgtggag
atgaataaggcagcaacttcccatttcaatatcagggtgatggagtgtcggctggctgcg
aagctcctggctaaatacaaaagcttgcaatgggacaaagtactgaggctggaggaggtg
caggctaaactagggattagtctagaagaaatgctgttggtcacagaagatgcccttcat
cctgaaccctataaccctgaggagatctgcaggtgtctgggaattagcctggaggaactc
cgaacccaaatcctgagtccaaacactcaagatgtgctcatcttcaaactctatcagcgg
gcaaagcatgtgtacagcgaggctgcgcgagtgctccagtttaagaagatatgtgaagaa
gcacctgaaaacatggtccagctgctgggagagttgatgaaccagagccacatgagctgc
cgggacatgtatgagtgcagctgccccgagctggatcagctggtggacatctgtcggaag
tttggggctcaagggtcacgacttactggagcaggatggggaggctgcacagtatcaatg
gtacctgcggacaagctgcccagctttctagcaaatgtgcacaaagcttattaccagagg
agtgatggaagcttagcaccggagaagcaaagtttgtttgctaccaaacctggaggtggg
gctttggttttgcttgaggcctga

DBGET integrated database retrieval system