KEGG   Homo sapiens (human): 2587Help
Entry
2587              CDS       T01001                                 

Gene name
GALR1, GALNR, GALNR1
Definition
galanin receptor 1
Orthology
K04230  
galanin receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
LinkDB All DBs
Position
18q23
AA seq 349 aa AA seqDB search
MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVTLVVFGLIFALGVLGNSLVITVLAR
SKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSML
VSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGCIWALSIAMASPVAYHQGLFHPR
ASNQTFCWEQWPDPRHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEA
SKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPLTPASFLFRITAHCLAYSNSSVNP
IIYAFLSENFRKAYKQVFKCHIRKDSHLSDTKESKSRIDTPPSTNCTHV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggagctggcggtcgggaacctcagcgagggcaacgcgagctggccggagccccccgcc
ccggagcccgggccgctgttcggcatcggcgtggagaacttcgtcacgctggtggtgttc
ggcctgatcttcgcgctgggtgtgctgggcaacagcctagtgatcaccgtgctggcgcgc
agcaagccgggcaagccgcggagcaccaccaacctgttcatcctcaacctgagcatcgcc
gacctggcctacctgctcttctgcatccccttccaggccaccgtgtacgcgctgcccacc
tgggtgctgggcgccttcatctgcaagttcatccactacttcttcaccgtgtccatgctg
gtgagcatcttcaccctggccgcgatgtccgtggaccgctacgtggccatcgtgcactcg
cggcgctcctcctccctcagggtgtcccgcaacgcgctgctgggcgtgggctgcatctgg
gcgctgtccattgccatggcctcgcccgtggcctaccaccagggcctcttccacccgcgc
gccagcaaccagaccttctgctgggagcagtggcccgaccctcgccacaagaaggcctac
gtggtgtgcaccttcgtcttcggctacctgctgccgctcctgctcatctgcttctgctat
gccaaggtccttaatcacttgcataaaaagttgaagaacatgtcaaagaagtctgaagca
tccaagaaaaagactgcacagacagttctggtggtggttgtggtgtttggaatctcctgg
ctgccgcaccacatcatccatctctgggctgagtttggagttttcccgctgacgccggct
tccttcctcttcagaatcaccgcccactgcctggcgtacagcaattcctccgtgaatcct
atcatttatgcatttctctctgaaaatttcaggaaggcctataaacaagtgttcaagtgt
cacattcgcaaagattcacacctgagtgatactaaagaaagtaaaagtcgaatagacacc
ccaccatcaaccaattgtactcatgtgtga

DBGET integrated database retrieval system