KEGG   Homo sapiens (human): 2625Help
Entry
2625              CDS       T01001                                 

Gene name
GATA3, HDR, HDRS
Definition
GATA binding protein 3
Orthology
K17895  
GATA-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
Inflammatory bowel disease (IBD)
Disease
H01271  
Hypoparathyroidism with sensorineural deafness and renal dysplasia
H01360  
Allergic rhinitis
Class
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
10p15
AA seq 444 aa AA seqDB search
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHV
PPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT
SIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE
KECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLL
GGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRP
LIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKE
GIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTP
TPMHPPSSLSFGPHHPSSMVTAMG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgacggcggaccagccgcgctgggtgagccaccaccaccccgccgtgctcaac
gggcagcacccggacacgcaccacccgggcctcagccactcctacatggacgcggcgcag
tacccgctgccggaggaggtggatgtgctttttaacatcgacggtcaaggcaaccacgtc
ccgccctactacggaaactcggtcagggccacggtgcagaggtaccctccgacccaccac
gggagccaggtgtgccgcccgcctctgcttcatggatccctaccctggctggacggcggc
aaagccctgggcagccaccacaccgcctccccctggaatctcagccccttctccaagacg
tccatccaccacggctccccggggcccctctccgtctaccccccggcctcgtcctcctcc
ttgtcggggggccacgccagcccgcacctcttcaccttcccgcccaccccgccgaaggac
gtctccccggacccatcgctgtccaccccaggctcggccggctcggcccggcaggacgag
aaagagtgcctcaagtaccaggtgcccctgcccgacagcatgaagctggagtcgtcccac
tcccgtggcagcatgaccgccctgggtggagcctcctcgtcgacccaccaccccatcacc
acctacccgccctacgtgcccgagtacagctccggactcttcccccccagcagcctgctg
ggcggctcccccaccggcttcggatgcaagtccaggcccaaggcccggtccagcacagaa
ggcagggagtgtgtgaactgtggggcaacctcgaccccactgtggcggcgagatggcacg
ggacactacctgtgcaacgcctgcgggctctatcacaaaatgaacggacagaaccggccc
ctcattaagcccaagcgaaggctgtctgcagccaggagagcagggacgtcctgtgcgaac
tgtcagaccaccacaaccacactctggaggaggaatgccaatggggaccctgtctgcaat
gcctgtgggctctactacaagcttcacaatattaacagacccctgactatgaagaaggaa
ggcatccagaccagaaaccgaaaaatgtctagcaaatccaaaaagtgcaaaaaagtgcat
gactcactggaggacttccccaagaacagctcgtttaacccggccgccctctccagacac
atgtcctccctgagccacatctcgcccttcagccactccagccacatgctgaccacgccc
acgccgatgcacccgccatccagcctgtcctttggaccacaccacccctccagcatggtc
accgccatgggttag

DBGET integrated database retrieval system