KEGG   Homo sapiens (human): 2625Help
Entry
2625              CDS       T01001                                 

Gene name
GATA3, HDR, HDRS
Definition
(RefSeq) GATA binding protein 3
  KO
K17895  
GATA-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
Th1 and Th2 cell differentiation
Inflammatory bowel disease (IBD)
Disease
H01271  
Hypoparathyroidism with sensorineural deafness and renal dysplasia
H01360  
Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    2625 (GATA3)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    2625 (GATA3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 GATA-factors
    2625 (GATA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
10p15
AA seq 443 aa AA seqDB search
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHV
PPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT
SIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE
KECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLL
GGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPL
IKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEG
IQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPT
PMHPPSSLSFGPHHPSSMVTAMG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgacggcggaccagccgcgctgggtgagccaccaccaccccgccgtgctcaac
gggcagcacccggacacgcaccacccgggcctcagccactcctacatggacgcggcgcag
tacccgctgccggaggaggtggatgtgctttttaacatcgacggtcaaggcaaccacgtc
ccgccctactacggaaactcggtcagggccacggtgcagaggtaccctccgacccaccac
gggagccaggtgtgccgcccgcctctgcttcatggatccctaccctggctggacggcggc
aaagccctgggcagccaccacaccgcctccccctggaatctcagccccttctccaagacg
tccatccaccacggctccccggggcccctctccgtctaccccccggcctcgtcctcctcc
ttgtcggggggccacgccagcccgcacctcttcaccttcccgcccaccccgccgaaggac
gtctccccggacccatcgctgtccaccccaggctcggccggctcggcccggcaggacgag
aaagagtgcctcaagtaccaggtgcccctgcccgacagcatgaagctggagtcgtcccac
tcccgtggcagcatgaccgccctgggtggagcctcctcgtcgacccaccaccccatcacc
acctacccgccctacgtgcccgagtacagctccggactcttcccccccagcagcctgctg
ggcggctcccccaccggcttcggatgcaagtccaggcccaaggcccggtccagcacaggc
agggagtgtgtgaactgtggggcaacctcgaccccactgtggcggcgagatggcacggga
cactacctgtgcaacgcctgcgggctctatcacaaaatgaacggacagaaccggcccctc
attaagcccaagcgaaggctgtctgcagccaggagagcagggacgtcctgtgcgaactgt
cagaccaccacaaccacactctggaggaggaatgccaatggggaccctgtctgcaatgcc
tgtgggctctactacaagcttcacaatattaacagacccctgactatgaagaaggaaggc
atccagaccagaaaccgaaaaatgtctagcaaatccaaaaagtgcaaaaaagtgcatgac
tcactggaggacttccccaagaacagctcgtttaacccggccgccctctccagacacatg
tcctccctgagccacatctcgcccttcagccactccagccacatgctgaccacgcccacg
ccgatgcacccgccatccagcctgtcctttggaccacaccacccctccagcatggtcacc
gccatgggttag

DBGET integrated database retrieval system