KEGG   Homo sapiens (human): 2692Help
Entry
2692              CDS       T01001                                 

Gene name
GHRHR, GHRFR, GRFR, IGHD1B
Definition
growth hormone releasing hormone receptor
Orthology
K04584  
growth hormone releasing hormone receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Disease
H00254  
Pituitary Dwarfism (PD)
Drug target
Sermorelin: 
Tesamorelin: 
Somatorelin: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
7p14
AA seq 423 aa AA seqDB search
MDRRMWGAHVFCVLSPLPTVLGHMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWD
GLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLA
EEESYFSTVKIIYTVGHSISIVALFVAITILVALRRLHCPRNYVHTQLFTTFILKAGAVF
LKDAALFHSDDTDHCSFSTVLCKVSVAASHFATMTNFSWLLAEAVYLNCLLASTSPSSRR
AFWWLVLAGWGLPVLFTGTWVSCKLAFEDIACWDLDDTSPYWWIIKGPIVLSVGVNFGLF
LNIIRILVRKLEPAQGSLHTQSQYWRLSKSTLFLIPLFGIHYIIFNFLPDNAGLGIRLPL
ELGLGSFQGFIVAILYCFLNQEVRTEISRKWHGHDPELLPAWRTRAKWTTPSRSAAKVLT
SMC
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggaccgccggatgtggggggcccacgtcttctgcgtgttgagcccgttaccgaccgta
ttgggccacatgcacccagaatgtgacttcatcacccagctgagagaggatgagagtgcc
tgtctacaagcagcagaggagatgcccaacaccaccctgggctgccctgcgacctgggat
gggctgctgtgctggccaacggcaggctctggcgagtgggtcaccctcccctgcccggat
ttcttctctcacttcagctcagagtcaggggctgtgaaacgggattgtactatcactggc
tggtctgagccctttccaccttaccctgtggcctgccctgtgcctctggagctgctggct
gaggaggaatcttacttctccacagtgaagattatctacaccgtgggccatagcatctct
attgtagccctcttcgtggccatcaccatcctggttgctctcaggaggctccactgcccc
cggaactacgtccacacccagctgttcaccacttttatcctcaaggcgggagctgtgttc
ctgaaggatgctgcccttttccacagcgacgacactgaccactgcagcttctccactgtt
ctatgcaaggtctctgtggccgcctcccatttcgccaccatgaccaacttcagctggctg
ttggcagaagccgtctacctgaactgcctcctggcctccacctcccccagctcaaggaga
gccttctggtggctggttctcgctggctgggggctgcccgtgctcttcactggcacgtgg
gtgagctgcaaactggccttcgaggacatcgcgtgctgggacctggacgacacctccccc
tactggtggatcatcaaagggcccattgtcctctcggtcggggtgaactttgggcttttt
ctcaatattatccgcatcctggtgaggaaactggagccagctcagggcagcctccatacc
cagtctcagtattggcgtctctccaagtcgacacttttcctgatcccactctttggaatt
cactacatcatcttcaacttcctgccagacaatgctggcctgggcatccgcctccccctg
gagctgggactgggttccttccagggcttcattgttgccatcctctactgcttcctcaac
caagaggtgaggactgagatctcacggaagtggcatggccatgaccctgagcttctgcca
gcctggaggacccgtgctaagtggaccacgccttcccgctcggcggcaaaggtgctgaca
tctatgtgctag

DBGET integrated database retrieval system