KEGG   Homo sapiens (human): 27089Help
Entry
27089             CDS       T01001                                 

Gene name
UQCRQ, MC3DN4, QCR8, QP-C, QPC, UQCR7
Definition
(RefSeq) ubiquinol-cytochrome c reductase complex III subunit VII
  KO
K00418  ubiquinol-cytochrome c reductase subunit 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
Module
hsa_M00152  Cytochrome bc1 complex
Disease
H00473  Mitochondrial respiratory chain deficiencies (MRCD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    27089 (UQCRQ)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    27089 (UQCRQ)
  Environmental adaptation
   04714 Thermogenesis
    27089 (UQCRQ)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    27089 (UQCRQ)
   05012 Parkinson's disease
    27089 (UQCRQ)
   05016 Huntington's disease
    27089 (UQCRQ)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    27089 (UQCRQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UcrQ Cyt_b-c1_8
Motif
Other DBs
NCBI-GeneID: 27089
NCBI-ProteinID: NP_055217
OMIM: 612080
HGNC: 29594
Ensembl: ENSG00000164405
Vega: OTTHUMG00000059836
Pharos: O14949(Tbio)
UniProt: O14949
LinkDB All DBs
Structure
PDB: 

Jmol
Position
5q31.1
AA seq 82 aa AA seqDB search
MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIY
TWGTEEFERSKRKNPAAYENDK
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcgagtttgggaatctgacgcggatgcggcatgtgatcagctacagcttgtca
ccgttcgagcagcgcgcctatccgcacgtcttcactaaaggaatccccaatgttctgcgc
cgcattcgggagtctttctttcgcgtggtgccgcagtttgtagtgttttatcttatctac
acatgggggactgaagagttcgagagatccaagaggaagaatccagctgcctatgaaaat
gacaaatga

DBGET integrated database retrieval system