KEGG   Homo sapiens (human): 2741Help
Entry
2741              CDS       T01001                                 

Gene name
GLRA1, HKPX1, STHE
Definition
glycine receptor, alpha 1
Orthology
K05193  
glycine receptor alpha-1
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Disease
H00769  
Hyperekplexia
Drug target
Glycine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2741 (GLRA1)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  Glycine
   2741 (GLRA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
5q32
AA seq 449 aa AA seqDB search
MYSFNTLRLYLWETIVFFSLAASKEAEAARSAPKPMSPSDFLDKLMGRTSGYDARIRPNF
KGPPVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYPDDSLDLDPSMLDS
IWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTC
IMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKHYNTGKFTCIEA
RFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRA
SLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRRHHKEDEAGEG
RFNFSAYGMGPACLQAKDGISVKGANNSNTTNPPPAPSKSPEEMRKLFIQRAKKIDKISR
IGFPMAFLIFNMFYWIIYKIVRREDVHNQ
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtacagcttcaatactcttcgactctacctttgggagaccattgtattcttcagcctt
gctgcttctaaggaggctgaagctgctcgctccgcacccaagcctatgtcaccctcggat
ttcctggataagctaatggggagaacctccggatatgatgccaggatcaggcccaatttt
aaaggtcccccagtgaacgtgagctgcaacattttcatcaacagctttggttccattgct
gagacaaccatggactatagggtcaacatcttcctgcggcagcaatggaacgacccccgc
ctggcctataatgaataccctgacgactctctggacctggacccatccatgctggactcc
atctggaaacctgacctgttctttgccaacgagaagggggcccacttccatgagatcacc
acagacaacaaattgctaaggatctcccggaatgggaatgtcctctacagcatcagaatc
accctgacactggcctgccccatggacttgaagaatttccccatggatgtccagacatgt
atcatgcaactggaaagctttggatatacgatgaatgacctcatctttgagtggcaggaa
cagggagccgtgcaggtagcagatggactaactctgccccagtttatcttgaaggaagag
aaggacttgagatactgcaccaagcactacaacacaggtaaattcacctgcattgaggcc
cggttccacctggagcggcagatgggttactacctgattcagatgtatattcccagcctg
ctcattgtcatcctctcatggatctccttctggatcaacatggatgctgcacctgctcgt
gtgggcctaggcatcaccactgtgctcaccatgaccacccagagctccggctctcgagca
tctctgcccaaggtgtcctatgtgaaagccattgacatttggatggcagtttgcctgctc
tttgtgttctcagccctattagaatatgctgccgttaactttgtgtctcggcaacataag
gagctgctccgattcaggaggaagcggagacatcacaaggaggatgaagctggagaaggc
cgctttaacttctctgcctatgggatgggcccagcctgtctacaggccaaggatggcatc
tcagtcaagggcgccaacaacagtaacaccaccaacccccctcctgcaccatctaagtcc
ccagaggagatgcgaaaactcttcatccagagggccaagaagatcgacaaaatatcccgc
attggcttccccatggccttcctcattttcaacatgttctactggatcatctacaagatt
gtccgtagagaggacgtccacaaccagtga

DBGET integrated database retrieval system