KEGG   Homo sapiens (human): 2760Help
Entry
2760              CDS       T01001                                 

Gene name
GM2A, GM2-AP, SAP-3
Definition
GM2 ganglioside activator
Orthology
K12383  
ganglioside GM2 activator
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Disease
H00124  
GM2 gangliosidoses
H00426  
Defects in the degradation of ganglioside
Class
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
5q33.1
AA seq 193 aa AA seqDB search
MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLEPDPIIV
PGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIP
TGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKR
LGCIKIAASLKGI
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccctgatgcaggctcccctcctgatcgccctgggcttgcttctcgcggcccct
gcgcaagcccacctgaaaaagccatcccagctcagtagcttttcctgggataactgtgat
gaagggaaggaccctgcggtgatcagaagcctgactctggagcctgaccccatcatcgtt
cctggaaatgtgaccctcagtgtcatgggcagcaccagtgtccccctgagttctcctctg
aaggtggatttagttttggagaaggaggtggctggcctctggatcaagatcccatgcaca
gactacattggcagctgtacctttgaacacttctgtgatgtgcttgacatgttaattcct
actggggagccctgcccagagcccctgcgtacctatgggcttccttgccactgtcccttc
aaagaaggaacctactcactgcccaagagcgaattcgttgtgcctgacctggagctgccc
agttggctcaccaccgggaactaccgcatagagagcgtcctgagcagcagtgggaagcgt
ctgggctgcatcaagatcgctgcctctctaaagggcatataa

DBGET integrated database retrieval system