KEGG   Homo sapiens (human): 2792Help
Entry
2792              CDS       T01001                                 

Gene name
GNGT1, GNG1
Definition
guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1
Orthology
K04548  
guanine nucleotide-binding protein G(T) subunit gamma-T1
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Phototransduction
Morphine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2792 (GNGT1)
   04151 PI3K-Akt signaling pathway
    2792 (GNGT1)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    2792 (GNGT1)
  Nervous system
   04724 Glutamatergic synapse
    2792 (GNGT1)
   04727 GABAergic synapse
    2792 (GNGT1)
   04725 Cholinergic synapse
    2792 (GNGT1)
   04728 Dopaminergic synapse
    2792 (GNGT1)
   04726 Serotonergic synapse
    2792 (GNGT1)
   04723 Retrograde endocannabinoid signaling
    2792 (GNGT1)
  Sensory system
   04744 Phototransduction
    2792 (GNGT1)
  Environmental adaptation
   04713 Circadian entrainment
    2792 (GNGT1)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    2792 (GNGT1)
   05034 Alcoholism
    2792 (GNGT1)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    2792 (GNGT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
7q21.3
AA seq 74 aa AA seqDB search
MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED
KNPFKELKGGCVIS
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgccagtaatcaatattgaggacctgacagaaaaggacaaattgaagatggaagttgac
cagctcaagaaagaagtgacactggaaagaatgctagtttccaaatgttgtgaagaagta
agagattacgttgaagaacgatctggcgaggatccactggtaaagggcatcccagaggac
aaaaatcccttcaaggagctcaaaggaggctgtgtgatttcataa

DBGET integrated database retrieval system