KEGG   Homo sapiens (human): 2792Help
Entry
2792              CDS       T01001                                 

Gene name
GNGT1, GNG1
Definition
(RefSeq) G protein subunit gamma transducin 1
  KO
K04548  guanine nucleotide-binding protein G(T) subunit gamma-T1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04062  Chemokine signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04371  Apelin signaling pathway
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04744  Phototransduction
hsa04926  Relaxin signaling pathway
hsa05032  Morphine addiction
hsa05034  Alcoholism
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
Network
N00152  CXCR-GNB/G-ERK signaling pathway
N00153  CXCR-GNB/G-PI3K-JNK signaling pathway
N00154  CXCR-GNB/G-PI3K-AKT signaling pathway
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
N00158  KSHV vGPCR to GNB/G-PI3K-AKT signaling pathway
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00206  KSHV vGPCR to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2792 (GNGT1)
   04371 Apelin signaling pathway
    2792 (GNGT1)
   04151 PI3K-Akt signaling pathway
    2792 (GNGT1)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    2792 (GNGT1)
  Endocrine system
   04926 Relaxin signaling pathway
    2792 (GNGT1)
  Nervous system
   04724 Glutamatergic synapse
    2792 (GNGT1)
   04727 GABAergic synapse
    2792 (GNGT1)
   04725 Cholinergic synapse
    2792 (GNGT1)
   04728 Dopaminergic synapse
    2792 (GNGT1)
   04726 Serotonergic synapse
    2792 (GNGT1)
   04723 Retrograde endocannabinoid signaling
    2792 (GNGT1)
  Sensory system
   04744 Phototransduction
    2792 (GNGT1)
  Environmental adaptation
   04713 Circadian entrainment
    2792 (GNGT1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2792 (GNGT1)
  Substance dependence
   05032 Morphine addiction
    2792 (GNGT1)
   05034 Alcoholism
    2792 (GNGT1)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    2792 (GNGT1)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    2792 (GNGT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma DUF2508
Motif
Other DBs
NCBI-GeneID: 2792
NCBI-ProteinID: NP_001316355
OMIM: 189970
HGNC: 4411
Ensembl: ENSG00000127928
Vega: OTTHUMG00000022908
Pharos: P63211(Tbio)
UniProt: P63211
LinkDB All DBs
Position
7q21.3
AA seq 74 aa AA seqDB search
MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED
KNPFKELKGGCVIS
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgccagtaatcaatattgaggacctgacagaaaaggacaaattgaagatggaagttgac
cagctcaagaaagaagtgacactggaaagaatgctagtttccaaatgttgtgaagaagta
agagattacgttgaagaacgatctggcgaggatccactggtaaagggcatcccagaggac
aaaaatcccttcaaggagctcaaaggaggctgtgtgatttcataa

DBGET integrated database retrieval system