KEGG   Homo sapiens (human): 2906Help
Entry
2906              CDS       T01001                                 

Gene name
GRIN2D, EB11, EIEE46, GluN2D, NMDAR2D, NR2D
Definition
(RefSeq) glutamate ionotropic receptor NMDA type subunit 2D
  KO
K05212  glutamate receptor ionotropic, NMDA 2D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04724  Glutamatergic synapse
hsa05010  Alzheimer's disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05033  Nicotine addiction
hsa05034  Alcoholism
Disease
H00606  Early infantile epileptic encephalopathy
Drug target
Acamprosate (DG00996): D02780 D07058
Amantadine (DG00860): D00777 D07441
Aptiganel hydrochloride: D02973
Budipine (DG00866): D07306 D07589
Delucemine hydrochloride: D03679
Dextromethorphan (DG01078): D00848 D03742 D03744
Dextrorphan hydrochloride: D03746
Dizocilpine maleate: D03878
Esketamine: D07283
Esketamine (DG01829): D10627
Flupirtine (DG00831): D04226 D07978 D07979
Gavestinel: D04308
Ketamine (DG00796): D00711 D08098
Ketobemidone (DG00815): D08100 D08101
Latrepirdine (DG01379): D09917 D09918
Levomethadone (DG01002): D08121 D08122
Licostinel: D04728
Memantine (DG00986): D04905 D08174
Methadone (DG00999): D02102 D08195
Neramexane mesylate: D05145
Orphenadrine (DG01252): D08305
Orphenadrine (chloride): D02599
Orphenadrine (citrate): D00774
Perzinfotel: D05447
Phencyclidine hydrochloride: D05453
Remacemide hydrochloride: D05714
Riluzole: D00775
Selfotel: D02410
Tiletamine (DG01380): D06146 D08596
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    2906 (GRIN2D)
   04024 cAMP signaling pathway
    2906 (GRIN2D)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2906 (GRIN2D)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    2906 (GRIN2D)
   04720 Long-term potentiation
    2906 (GRIN2D)
  Environmental adaptation
   04713 Circadian entrainment
    2906 (GRIN2D)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    2906 (GRIN2D)
   05014 Amyotrophic lateral sclerosis (ALS)
    2906 (GRIN2D)
  Substance dependence
   05030 Cocaine addiction
    2906 (GRIN2D)
   05031 Amphetamine addiction
    2906 (GRIN2D)
   05033 Nicotine addiction
    2906 (GRIN2D)
   05034 Alcoholism
    2906 (GRIN2D)
Ion channels [BR:hsa04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), NMDA
   2906 (GRIN2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor NMDAR2_C MatE
Motif
Other DBs
NCBI-GeneID: 2906
NCBI-ProteinID: NP_000827
OMIM: 602717
HGNC: 4588
Ensembl: ENSG00000105464
Vega: OTTHUMG00000183304
Pharos: O15399(Tclin)
UniProt: O15399 Q59G17
LinkDB All DBs
Position
19q13.33
AA seq 1336 aa AA seqDB search
MRGAGGPRGPRGPAKMLLLLALACASPFPEEAPGPGGAGGPGGGLGGARPLNVALVFSGP
AYAAEAARLGPAVAAAVRSPGLDVRPVALVLNGSDPRSLVLQLCDLLSGLRVHGVVFEDD
SRAPAVAPILDFLSAQTSLPIVAVHGGAALVLTPKEKGSTFLQLGSSTEQQLQVIFEVLE
EYDWTSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEHRGALTLDPGAGEAVLSAQLRSVS
AQIRLLFCAREEAEPVFRAAEEAGLTGSGYVWFMVGPQLAGGGGSGAPGEPPLLPGGAPL
PAGLFAVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRAQNRTHRGESL
HRYFMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYG
RFLQPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPE
KRCCKGFCIDILKRLAHTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSL
TINEERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVT
VFIFEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVL
VWAFFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGSTEK
NIRSNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKDEGCKLVTIGS
GKVFATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKL
DIDNMAGVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSRGMYSCCSAE
AAPPPAKPPPPPQPLPSPAYPAPRPAPGPAPFVPRERASVDRWRRTKGAGPPGGAGLADG
FHRYYGPIEPQGLGLGLGEARAAPRGAAGRPLSPPAAQPPQKPPPSYFAIVRDKEPAEPP
AGAFPGFPSPPAPPAAAATAVGPPLCRLAFEDESPPAPARWPRSDPESQPLLGPGAGGAG
GTGGAGGGAPAAPPPCRAAPPPCPYLDLEPSPSDSEDSESLGGASLGGLEPWWFADFPYP
YAERLGPPPGRYWSVDKLGGWRAGSWDYLPPRSGPAAWHCRHCASLELLPPPRHLSCSHD
GLDGGWWAPPPPPWAAGPLPRRRARCGCPRSHPHRPRASHRTPAAAAPHHHRHRRAAGGW
DLPPPAPTSRSLEDLSSCPRAAPARRLTGPSRHARRCPHAAHWGPPLPTASHRRHRGGDL
GTRRGSAHFSSLESEV
NT seq 4011 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcgccggtggcccccgcggccctcggggccccgctaagatgctgctgctgctg
gcgctggcctgcgccagcccgttcccggaggaggcgccggggccgggcggggccggtggg
cccggcggcggcctcggcggggcgcggccgctcaacgtggcgctcgtgttctcggggccc
gcgtacgcggccgaggcggcacgcctgggcccggccgtggcggcggcggtgcgcagcccg
ggcctagacgtgcggcccgtggcgctggtgctcaacggctcggacccgcgcagcctcgtg
ctgcagctctgcgacctgctgtcggggttgcgcgtgcacggcgtggtcttcgaagacgac
tcgcgcgcgcccgccgtcgcgcccatcctcgacttcctgtcggcgcagacctcgctgccc
atcgtggccgtgcacggcggcgccgcgctcgtgctcacgcccaaggagaagggctccacc
ttcctgcagctgggctcttccaccgagcaacagcttcaggtcatctttgaggtgctggag
gagtatgactggacgtcctttgtagccgtgaccactcgtgcccctggccaccgggccttc
ctgtcctacattgaggtgctgactgacggtagtctggtgggctgggagcaccgcggagcg
ctgacgctggaccctggggcgggcgaggccgtgctcagtgcccagctccgcagtgtcagc
gcgcagatccgcctgctcttctgcgcccgagaggaggccgagcccgtgttccgcgcagct
gaggaggctggcctcactggatctggctacgtctggttcatggtggggccccagctggct
ggaggcgggggctctggggcccctggtgagccccctcttctgccaggaggcgcccccctg
cctgccgggctgtttgcagtgcgctcggctggctggcgggatgacctggctcggcgagtg
gcagctggcgtggccgtagtggccagaggtgcccaggccctgctgcgtgattatggtttc
cttcctgagctcggccacgactgtcgcgcccagaaccgcacccaccgcggcgagagtctg
cataggtacttcatgaacatcacgtgggataaccgggattactccttcaatgaggacggc
ttcctagtgaacccctccctggtggtcatctccctcaccagagacaggacgtgggaggtg
gtgggcagctgggagcagcagacgctccgcctcaagtacccgctgtggtcccgctatggt
cgcttcctgcagccagtggacgacacgcagcacctcacggtggccacgctggaggaaagg
ccgtttgtcatcgtggagcctgcagaccctatcagcggcacctgcatccgagactccgtc
ccctgccggagccagctcaaccgaacccacagccctccaccggatgccccccgcccggaa
aagcgctgctgcaagggtttctgcatcgacattctgaagcggctggcgcataccatcggc
ttcagctacgacctctacctggtcaccaatggcaagcacggaaagaagatcgatggcgtc
tggaacggcatgatcggggaggtgttctaccagcgcgcagacatggccatcggctccctc
accatcaacgaggagcgctccgagatcgtggacttctccgtccccttcgtggagaccggc
atcagcgtcatggtggcgcgcagcaatggcacggtgtccccctcggccttcctcgagccc
tacagccccgccgtgtgggtgatgatgttcgtcatgtgcctcactgtggtcgccgtcact
gttttcatcttcgagtacctcagtcctgttggttacaaccgcagcctggccacgggcaag
cgccctggcggttcaaccttcaccattgggaaatccatctggctgctctgggccctggtg
ttcaataattcggtgcccgtggagaacccccggggaaccaccagcaaaatcatggtgctg
gtgtgggccttcttcgccgtcatcttcctcgccagctacacagccaacctggccgccttc
atgatccaggaggagtacgtggatactgtgtctgggctcagtgaccgcaagttccagagg
ccccaggagcagtacccgcccctgaagtttgggaccgtgcccaacggctccacggagaag
aacatccgcagcaactatcccgacatgcacagctacatggtgcgctacaaccagccccgc
gtagaggaagcgctcactcagctcaaggcagggaagctggacgccttcatctacgatgct
gcagtgctcaattacatggcccgcaaggacgagggctgcaagcttgtcaccatcggctcc
ggcaaggtcttcgccacgacaggctatggcatcgccctgcacaagggctcccgctggaag
cggcccatcgacctggcgttgctgcagttcctgggggatgatgagatcgagatgctggag
cggctgtggctctctgggatctgccacaatgacaaaatcgaggtgatgagcagcaagctg
gacatcgacaacatggcgggcgtcttctacatgctcctggtggccatgggcctgtccctg
ctggtcttcgcctgggagcacctggtgtactggcgcctgcggcactgcctggggcccacc
caccgcatggacttcctgctggccttctccaggggcatgtacagctgctgcagcgctgag
gccgccccaccgcccgccaagcccccgccgccgccacagcccctgcccagccccgcgtac
cccgcgccgcggccggctcccgggcccgcacctttcgtgccccgcgagcgcgcctcagtg
gaccgctggcgccggaccaagggcgcggggccgccggggggcgcgggcctggccgacggc
ttccaccgctactacggccccatcgagccgcagggcctaggcctcggcctgggcgaagcg
cgcgcggcaccgcggggcgcagccgggcgcccgctgtccccgccggccgctcagcccccg
cagaagccgccgccctcctatttcgccatcgtacgcgacaaggagccagccgagcccccc
gccggcgccttccccggcttcccgtcgccgcccgcgccccccgccgccgcggccaccgcc
gtcgggccgccactctgccgcttggccttcgaggacgagagcccgccggcgcccgcgcgg
tggccgcgctcggaccccgagagccaacccctgctggggccaggcgcgggcggcgcgggg
ggcacggggggcgcaggcggaggagccccggccgctccgcccccgtgccgcgccgcgccg
cccccgtgcccttacctcgatctcgagccgtcgccgtcggactcggaggactcggagagc
ctgggcggcgcgtcgctgggcggcctggagccctggtggttcgccgacttcccttacccg
tatgccgagcgcctcgggccgccgcccggccgctactggtcggtcgacaagctcgggggc
tggcgcgccgggagctgggactacctgcccccgcgcagcggtccggccgcctggcactgt
cggcactgcgccagcctggagctgctgccgccgccgcgccatctcagctgctcgcacgat
ggcctggacggcggctggtgggcgccaccgcctccaccctgggccgccgggcccctgccc
cgacgccgggcccgctgcgggtgcccgcggtcgcacccgcaccgcccgcgggcctcgcac
cgcacgcccgccgccgccgcgccccaccaccacaggcaccggcgcgccgctgggggctgg
gacctcccgccgcccgcgcccacctcgcgctcgctcgaggacctcagctcgtgccctcgc
gccgcccctgcgcgcaggcttaccgggccctcccgccacgctcgcaggtgtccgcacgcc
gcgcactgggggccgccgctgcccacagcttcccaccggagacaccggggcggggacctg
ggcacccgcaggggctcggcgcacttctctagcctcgagtccgaggtatga

DBGET integrated database retrieval system