KEGG   Homo sapiens (human): 2906Help
Entry
2906              CDS       T01001                                 

Gene name
GRIN2D, EB11, GluN2D, NMDAR2D, NR2D
Definition
glutamate receptor, ionotropic, N-methyl D-aspartate 2D
Orthology
K05212  
glutamate receptor ionotropic, NMDA 2D
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Long-term potentiation
Glutamatergic synapse
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Cocaine addiction
Amphetamine addiction
Nicotine addiction
Alcoholism
Drug target
Ketamine: 
Esketamine: 
Ketobemidone: 
Flupirtine: 
Memantine: 
Acamprosate: 
Methadone: 
Levomethadone: 
Dextromethorphan, combinations: 
Dextromethorphan: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    2906 (GRIN2D)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2906 (GRIN2D)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    2906 (GRIN2D)
   04720 Long-term potentiation
    2906 (GRIN2D)
  Environmental adaptation
   04713 Circadian entrainment
    2906 (GRIN2D)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    2906 (GRIN2D)
   05014 Amyotrophic lateral sclerosis (ALS)
    2906 (GRIN2D)
  Substance dependence
   05030 Cocaine addiction
    2906 (GRIN2D)
   05031 Amphetamine addiction
    2906 (GRIN2D)
   05033 Nicotine addiction
    2906 (GRIN2D)
   05034 Alcoholism
    2906 (GRIN2D)
Ion channels [BR:hsa04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), NMDA
   2906 (GRIN2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
19q13.33
AA seq 1336 aa AA seqDB search
MRGAGGPRGPRGPAKMLLLLALACASPFPEEAPGPGGAGGPGGGLGGARPLNVALVFSGP
AYAAEAARLGPAVAAAVRSPGLDVRPVALVLNGSDPRSLVLQLCDLLSGLRVHGVVFEDD
SRAPAVAPILDFLSAQTSLPIVAVHGGAALVLTPKEKGSTFLQLGSSTEQQLQVIFEVLE
EYDWTSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEHRGALTLDPGAGEAVLSAQLRSVS
AQIRLLFCAREEAEPVFRAAEEAGLTGSGYVWFMVGPQLAGGGGSGAPGEPPLLPGGAPL
PAGLFAVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRAQNRTHRGESL
HRYFMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYG
RFLQPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPE
KRCCKGFCIDILKRLAHTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSL
TINEERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVT
VFIFEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVL
VWAFFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGSTEK
NIRSNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKDEGCKLVTIGS
GKVFATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKL
DIDNMAGVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSRGMYSCCSAE
AAPPPAKPPPPPQPLPSPAYPAPRPAPGPAPFVPRERASVDRWRRTKGAGPPGGAGLADG
FHRYYGPIEPQGLGLGLGEARAAPRGAAGRPLSPPAAQPPQKPPPSYFAIVRDKEPAEPP
AGAFPGFPSPPAPPAAAATAVGPPLCRLAFEDESPPAPARWPRSDPESQPLLGPGAGGAG
GTGGAGGGAPAAPPPCRAAPPPCPYLDLEPSPSDSEDSESLGGASLGGLEPWWFADFPYP
YAERLGPPPGRYWSVDKLGGWRAGSWDYLPPRSGPAAWHCRHCASLELLPPPRHLSCSHD
GLDGGWWAPPPPPWAAGPLPRRRARCGCPRSHPHRPRASHRTPAAAAPHHHRHRRAAGGW
DLPPPAPTSRSLEDLSSCPRAAPARRLTGPSRHARRCPHAAHWGPPLPTASHRRHRGGDL
GTRRGSAHFSSLESEV
NT seq 4011 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcgccggtggcccccgcggccctcggggccccgctaagatgctgctgctgctg
gcgctggcctgcgccagcccgttcccggaggaggcgccggggccgggcggggccggtggg
cccggcggcggcctcggcggggcgcggccgctcaacgtggcgctcgtgttctcggggccc
gcgtacgcggccgaggcggcacgcctgggcccggccgtggcggcggcggtgcgcagcccg
ggcctagacgtgcggcccgtggcgctggtgctcaacggctcggacccgcgcagcctcgtg
ctgcagctctgcgacctgctgtcggggttgcgcgtgcacggcgtggtcttcgaagacgac
tcgcgcgcgcccgccgtcgcgcccatcctcgacttcctgtcggcgcagacctcgctgccc
atcgtggccgtgcacggcggcgccgcgctcgtgctcacgcccaaggagaagggctccacc
ttcctgcagctgggctcttccaccgagcaacagcttcaggtcatctttgaggtgctggag
gagtatgactggacgtcctttgtagccgtgaccactcgtgcccctggccaccgggccttc
ctgtcctacattgaggtgctgactgacggtagtctggtgggctgggagcaccgcggagcg
ctgacgctggaccctggggcgggcgaggccgtgctcagtgcccagctccgcagtgtcagc
gcgcagatccgcctgctcttctgcgcccgagaggaggccgagcccgtgttccgcgcagct
gaggaggctggcctcactggatctggctacgtctggttcatggtggggccccagctggct
ggaggcgggggctctggggcccctggtgagccccctcttctgccaggaggcgcccccctg
cctgccgggctgtttgcagtgcgctcggctggctggcgggatgacctggctcggcgagtg
gcagctggcgtggccgtagtggccagaggtgcccaggccctgctgcgtgattatggtttc
cttcctgagctcggccacgactgtcgcgcccagaaccgcacccaccgcggcgagagtctg
cataggtacttcatgaacatcacgtgggataaccgggattactccttcaatgaggacggc
ttcctagtgaacccctccctggtggtcatctccctcaccagagacaggacgtgggaggtg
gtgggcagctgggagcagcagacgctccgcctcaagtacccgctgtggtcccgctatggt
cgcttcctgcagccagtggacgacacgcagcacctcacggtggccacgctggaggaaagg
ccgtttgtcatcgtggagcctgcagaccctatcagcggcacctgcatccgagactccgtc
ccctgccggagccagctcaaccgaacccacagccctccaccggatgccccccgcccggaa
aagcgctgctgcaagggtttctgcatcgacattctgaagcggctggcgcataccatcggc
ttcagctacgacctctacctggtcaccaatggcaagcacggaaagaagatcgatggcgtc
tggaacggcatgatcggggaggtgttctaccagcgcgcagacatggccatcggctccctc
accatcaacgaggagcgctccgagatcgtggacttctccgtccccttcgtggagaccggc
atcagcgtcatggtggcgcgcagcaatggcacggtgtccccctcggccttcctcgagccc
tacagccccgccgtgtgggtgatgatgttcgtcatgtgcctcactgtggtcgccgtcact
gttttcatcttcgagtacctcagtcctgttggttacaaccgcagcctggccacgggcaag
cgccctggcggttcaaccttcaccattgggaaatccatctggctgctctgggccctggtg
ttcaataattcggtgcccgtggagaacccccggggaaccaccagcaaaatcatggtgctg
gtgtgggccttcttcgccgtcatcttcctcgccagctacacagccaacctggccgccttc
atgatccaggaggagtacgtggatactgtgtctgggctcagtgaccgcaagttccagagg
ccccaggagcagtacccgcccctgaagtttgggaccgtgcccaacggctccacggagaag
aacatccgcagcaactatcccgacatgcacagctacatggtgcgctacaaccagccccgc
gtagaggaagcgctcactcagctcaaggcagggaagctggacgccttcatctacgatgct
gcagtgctcaattacatggcccgcaaggacgagggctgcaagcttgtcaccatcggctcc
ggcaaggtcttcgccacgacaggctatggcatcgccctgcacaagggctcccgctggaag
cggcccatcgacctggcgttgctgcagttcctgggggatgatgagatcgagatgctggag
cggctgtggctctctgggatctgccacaatgacaaaatcgaggtgatgagcagcaagctg
gacatcgacaacatggcgggcgtcttctacatgctcctggtggccatgggcctgtccctg
ctggtcttcgcctgggagcacctggtgtactggcgcctgcggcactgcctggggcccacc
caccgcatggacttcctgctggccttctccaggggcatgtacagctgctgcagcgctgag
gccgccccaccgcccgccaagcccccgccgccgccacagcccctgcccagccccgcgtac
cccgcgccgcggccggctcccgggcccgcacctttcgtgccccgcgagcgcgcctcagtg
gaccgctggcgccggaccaagggcgcggggccgccggggggcgcgggcctggccgacggc
ttccaccgctactacggccccatcgagccgcagggcctaggcctcggcctgggcgaagcg
cgcgcggcaccgcggggcgcagccgggcgcccgctgtccccgccggccgctcagcccccg
cagaagccgccgccctcctatttcgccatcgtacgcgacaaggagccagccgagcccccc
gccggcgccttccccggcttcccgtcgccgcccgcgccccccgccgccgcggccaccgcc
gtcgggccgccactctgccgcttggccttcgaggacgagagcccgccggcgcccgcgcgg
tggccgcgctcggaccccgagagccaacccctgctggggccaggcgcgggcggcgcgggg
ggcacggggggcgcaggcggaggagccccggccgctccgcccccgtgccgcgccgcgccg
cccccgtgcccttacctcgatctcgagccgtcgccgtcggactcggaggactcggagagc
ctgggcggcgcgtcgctgggcggcctggagccctggtggttcgccgacttcccttacccg
tatgccgagcgcctcgggccgccgcccggccgctactggtcggtcgacaagctcgggggc
tggcgcgccgggagctgggactacctgcccccgcgcagcggtccggccgcctggcactgt
cggcactgcgccagcctggagctgctgccgccgccgcgccatctcagctgctcgcacgat
ggcctggacggcggctggtgggcgccaccgcctccaccctgggccgccgggcccctgccc
cgacgccgggcccgctgcgggtgcccgcggtcgcacccgcaccgcccgcgggcctcgcac
cgcacgcccgccgccgccgcgccccaccaccacaggcaccggcgcgccgctgggggctgg
gacctcccgccgcccgcgcccacctcgcgctcgctcgaggacctcagctcgtgccctcgc
gccgcccctgcgcgcaggcttaccgggccctcccgccacgctcgcaggtgtccgcacgcc
gcgcactgggggccgccgctgcccacagcttcccaccggagacaccggggcggggacctg
ggcacccgcaggggctcggcgcacttctctagcctcgagtccgaggtatga

DBGET integrated database retrieval system