KEGG   Homo sapiens (human): 2908Help
Entry
2908              CDS       T01001                                 

Gene name
NR3C1, GCCR, GCR, GCRST, GR, GRL
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1
  KO
K05771  
glucocorticoid receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Disease
H00599  
46,XX disorders of sex development (Disorders related to androgen excess)
H01702  
Glucocorticoid resistance
H01709  
Glucocorticoid-induced osteonecrosis
Drug target
Alclometasone (DG00415): 
Amcinonide: 
Beclometasone (DG00097): 
Betamethasone (DG00095): 
Budesonide: 
Ciclesonide: 
Clobetasol (DG00422): 
Clobetasone (DG00411): 
Clocortolone (DG00416): 
Cloprednol: 
Cortisone (DG00509): 
Cortivazol: 
Cortodoxone: 
Dagrocorat: 
Deflazacort: 
Desonide: 
Desoximetasone: 
Dexamethasone (DG00011): 
Diflorasone (DG00418): 
Diflucortolone (DG00417): 
Difluprednate: 
Fluclorolone: 
Fludrocortisone (DG00506): 
Fludroxycortide: 
Flumetasone (DG00412): 
Flunisolide (DG01040): 
Fluocinolone acetonide: 
Fluocinonide: 
Fluocortin (DG00413): 
Fluocortolone (DG00295): 
Fluorometholone (DG00294): 
Fluprednidene (DG00414): 
Fluprednisolone: 
Fluprednisolone valerate: 
Fluticasone (DG00420): 
Fosdagrocorat: 
Halometasone: 
Halopredone (DG01376): 
Hydrocortisone (DG00012): 
Loteprednol (DG01127): 
Mapracorat: 
Medrysone: 
Meprednisone: 
Methylprednisolone (DG00410): 
Mometasone (DG00419): 
Paramethasone (DG00508): 
Prednicarbate: 
Prednisolone (DG00093): 
Prednisone (DG00094): 
Prednylidene: 
Proligestone: 
Resocortol (DG01545): 
Rimexolone: 
Tixocortol (DG00096): 
Triamcinolone (DG00010): 
Ulobetasol (DG00421): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2908 (NR3C1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    2908 (NR3C1)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   2908 (NR3C1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
5q31.3
AA seq 777 aa AA seqDB search
MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRR
LLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLK
LLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN
VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGN
SNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTV
YCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG
SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL
CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRK
CLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIE
PEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW
MFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSY
EEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK
LLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atggactccaaagaatcattaactcctggtagagaagaaaaccccagcagtgtgcttgct
caggagaggggagatgtgatggacttctataaaaccctaagaggaggagctactgtgaag
gtttctgcgtcttcaccctcactggctgtcgcttctcaatcagactccaagcagcgaaga
cttttggttgattttccaaaaggctcagtaagcaatgcgcagcagccagatctgtccaaa
gcagtttcactctcaatgggactgtatatgggagagacagaaacaaaagtgatgggaaat
gacctgggattcccacagcagggccaaatcagcctttcctcgggggaaacagacttaaag
cttttggaagaaagcattgcaaacctcaataggtcgaccagtgttccagagaaccccaag
agttcagcatccactgctgtgtctgctgcccccacagagaaggagtttccaaaaactcac
tctgatgtatcttcagaacagcaacatttgaagggccagactggcaccaacggtggcaat
gtgaaattgtataccacagaccaaagcacctttgacattttgcaggatttggagttttct
tctgggtccccaggtaaagagacgaatgagagtccttggagatcagacctgttgatagat
gaaaactgtttgctttctcctctggcgggagaagacgattcattccttttggaaggaaac
tcgaatgaggactgcaagcctctcattttaccggacactaaacccaaaattaaggataat
ggagatctggttttgtcaagccccagtaatgtaacactgccccaagtgaaaacagaaaaa
gaagatttcatcgaactctgcacccctggggtaattaagcaagagaaactgggcacagtt
tactgtcaggcaagctttcctggagcaaatataattggtaataaaatgtctgccatttct
gttcatggtgtgagtacctctggaggacagatgtaccactatgacatgaatacagcatcc
ctttctcaacagcaggatcagaagcctatttttaatgtcattccaccaattcccgttggt
tccgaaaattggaataggtgccaaggatctggagatgacaacttgacttctctggggact
ctgaacttccctggtcgaacagttttttctaatggctattcaagccccagcatgagacca
gatgtaagctctcctccatccagctcctcaacagcaacaacaggaccacctcccaaactc
tgcctggtgtgctctgatgaagcttcaggatgtcattatggagtcttaacttgtggaagc
tgtaaagttttcttcaaaagagcagtggaaggacagcacaattacctatgtgctggaagg
aatgattgcatcatcgataaaattcgaagaaaaaactgcccagcatgccgctatcgaaaa
tgtcttcaggctggaatgaacctggaagctcgaaaaacaaagaaaaaaataaaaggaatt
cagcaggccactacaggagtctcacaagaaacctctgaaaatcctggtaacaaaacaata
gttcctgcaacgttaccacaactcacccctaccctggtgtcactgttggaggttattgaa
cctgaagtgttatatgcaggatatgatagctctgttccagactcaacttggaggatcatg
actacgctcaacatgttaggagggcggcaagtgattgcagcagtgaaatgggcaaaggca
ataccaggtttcaggaacttacacctggatgaccaaatgaccctactgcagtactcctgg
atgtttcttatggcatttgctctggggtggagatcatatagacaatcaagtgcaaacctg
ctgtgttttgctcctgatctgattattaatgagcagagaatgactctaccctgcatgtac
gaccaatgtaaacacatgctgtatgtttcctctgagttacacaggcttcaggtatcttat
gaagagtatctctgtatgaaaaccttactgcttctctcttcagttcctaaggacggtctg
aagagccaagagctatttgatgaaattagaatgacctacatcaaagagctaggaaaagcc
attgtcaagagggaaggaaactccagccagaactggcagcggttttatcaactgacaaaa
ctcttggattctatgcatgaagtggttgaaaatctccttaactattgcttccaaacattt
ttggataagaccatgagtattgaattccccgagatgttagctgaaatcatcaccaatcag
ataccaaaatattcaaatggaaatatcaaaaaacttctgtttcatcaaaagtga

DBGET integrated database retrieval system