KEGG   Homo sapiens (human): 2934Help
Entry
2934              CDS       T01001                                 

Gene name
GSN, ADF, AGEL
Definition
gelsolin
Orthology
K05768  
gelsolin
Organism
hsa  Homo sapiens (human)
Pathway
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Viral carcinogenesis
Disease
H00845  
Familial amyloidosis
H00956  
Lattice corneal dystrophies (LCD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2934 (GSN)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    2934 (GSN)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    2934 (GSN)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2934 (GSN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
9q33
AA seq 782 aa AA seqDB search
MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRVPEARPNSMVVEHPEFL
KAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNEC
SQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVV
PNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKA
TQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKL
YKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALK
TASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERV
PFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNY
RHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFG
GKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPS
AAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDK
KMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEK
TEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAEL
AA
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggctccgcaccgccccgcgcccgcgctgctttgcgcgctgtccctggcgctgtgcgcg
ctgtcgctgcccgtccgcgcggccactgcgtcgcggggggcgtcccaggcgggggcgccc
caggggcgggtgcccgaggcgcggcccaacagcatggtggtggaacaccccgagttcctc
aaggcagggaaggagcctggcctgcagatctggcgtgtggagaagttcgatctggtgccc
gtgcccaccaacctttatggagacttcttcacgggcgacgcctacgtcatcctgaagaca
gtgcagctgaggaacggaaatctgcagtatgacctccactactggctgggcaatgagtgc
agccaggatgagagcggggcggccgccatctttaccgtgcagctggatgactacctgaac
ggccgggccgtgcagcaccgtgaggtccagggcttcgagtcggccaccttcctaggctac
ttcaagtctggcctgaagtacaagaaaggaggtgtggcatcaggattcaagcacgtggta
cccaacgaggtggtggtgcagagactcttccaggtcaaagggcggcgtgtggtccgtgcc
accgaggtacctgtgtcctgggagagcttcaacaatggcgactgcttcatcctggacctg
ggcaacaacatccaccagtggtgtggttccaacagcaatcggtatgaaagactgaaggcc
acacaggtgtccaagggcatccgggacaacgagcggagtggccgggcccgagtgcacgtg
tctgaggagggcactgagcccgaggcgatgctccaggtgctgggccccaagccggctctg
cctgcaggtaccgaggacaccgccaaggaggatgcggccaaccgcaagctggccaagctc
tacaaggtctccaatggtgcagggaccatgtccgtctccctcgtggctgatgagaacccc
ttcgcccagggggccctgaagtcagaggactgcttcatcctggaccacggcaaagatggg
aaaatctttgtctggaaaggcaagcaggcaaacacggaggagaggaaggctgccctcaaa
acagcctctgacttcatcaccaagatggactaccccaagcagactcaggtctcggtcctt
cctgagggcggtgagaccccactgttcaagcagttcttcaagaactggcgggacccagac
cagacagatggcctgggcttgtcctacctttccagccatatcgccaacgtggagcgggtg
cccttcgacgccgccaccctgcacacctccactgccatggccgcccagcacggcatggat
gacgatggcacaggccagaaacagatctggagaatcgaaggttccaacaaggtgcccgtg
gaccctgccacatatggacagttctatggaggcgacagctacatcattctgtacaactac
cgccatggtggccgccaggggcagataatctataactggcagggtgcccagtctacccag
gatgaggtcgctgcatctgccatcctgactgctcagctggatgaggagctgggaggtacc
cctgtccagagccgtgtggtccaaggcaaggagcccgcccacctcatgagcctgtttggt
gggaagcccatgatcatctacaagggcggcacctcccgcgagggcgggcagacagcccct
gccagcacccgcctcttccaggtccgcgccaacagcgctggagccacccgggctgttgag
gtattgcctaaggctggtgcactgaactccaacgatgcctttgttctgaaaaccccctca
gccgcctacctgtgggtgggtacaggagccagcgaggcagagaagacgggggcccaggag
ctgctcagggtgctgcgggcccaacctgtgcaggtggcagaaggcagcgagccagatggc
ttctgggaggccctgggcgggaaggctgcctaccgcacatccccacggctgaaggacaag
aagatggatgcccatcctcctcgcctctttgcctgctccaacaagattggacgttttgtg
atcgaagaggttcctggtgagctcatgcaggaagacctggcaacggatgacgtcatgctt
ctggacacctgggaccaggtctttgtctgggttggaaaggattctcaagaagaagaaaag
acagaagccttgacttctgctaagcggtacatcgagacggacccagccaatcgggatcgg
cggacgcccatcaccgtggtgaagcaaggctttgagcctccctcctttgtgggctggttc
cttggctgggatgatgattactggtctgtggaccccttggacagggccatggctgagctg
gctgcctga

DBGET integrated database retrieval system