KEGG   Homo sapiens (human): 2956Help
Entry
2956              CDS       T01001                                 

Gene name
MSH6, GTBP, GTMBP, HNPCC5, HSAP, p160
Definition
mutS homolog 6
Orthology
K08737  
DNA mismatch repair protein MSH6
Organism
hsa  Homo sapiens (human)
Pathway
Mismatch repair
Pathways in cancer
Colorectal cancer
Module
BRCA1-associated genome surveillance complex (BASC)
Disease
H00020  
Colorectal cancer
H00876  
Mismatch repair deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03430 Mismatch repair
    2956 (MSH6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2956 (MSH6)
   05210 Colorectal cancer
    2956 (MSH6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2p16
AA seq 1360 aa AA seqDB search
MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPL
ARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFI
REKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRAD
EALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRR
SSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR
KRMVTGNGSLKRKSSRKETPSATKQATSISSETKNTLRAFSAPQNSESQAHVSGGGDDSS
RPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQIKSQN
FDLVICYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQKGYKV
ARVEQTETPEMMEARCRKMAHISKYDRVVRREICRIITKGTQTYSVLEGDPSENYSKYLL
SLKEKEEDSSGHTRAYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGN
LSKETKTILKSSLSCSLQEGLIPGSQFWDASKTLRTLLEEEYFREKLSDGIGVMLPQVLK
GMTSESDSIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDTVSTT
RSGAIFTKAYQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERVDTCHTPFGKRLLKQWLCA
PLCNHYAINDRLDAIEDLMVVPDKISEVVELLKKLPDLERLLSKIHNVGSPLKSQNHPDS
RAIMYEETTYSKKKIIDFLSALEGFKVMCKIIGIMEEVADGFKSKILKQVISLQTKNPEG
RFPDLTVELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRN
RIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLIN
AEERRDVSLKDCMRRLFYNFDKNYKDWQSAVECIAVLDVLLCLANYSRGGDGPMCRPVIL
LPEDTPPFLELKGSRHPCITKTFFGDDFIPNDILIGCEEEEQENGKAYCVLVTGPNMGGK
STLMRQAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASI
LMHATAHSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSQNV
AVRLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKA
REFEKMNQSLRLFREVCLASERSTVDAEAVHKLLTLIKEL
NT seq 4083 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgacagagcaccctgtacagcttcttccccaagtctccggcgctgagtgatgcc
aacaaggcctcggccagggcctcacgcgaaggcggccgtgccgccgctgcccccggggcc
tctccttccccaggcggggatgcggcctggagcgaggctgggcctgggcccaggcccttg
gcgcgctccgcgtcaccgcccaaggcgaagaacctcaacggagggctgcggagatcggta
gcgcctgctgcccccaccagttgtgacttctcaccaggagatttggtttgggccaagatg
gagggttacccctggtggccttgtctggtttacaaccacccctttgatggaacattcatc
cgcgagaaagggaaatcagtccgtgttcatgtacagttttttgatgacagcccaacaagg
ggctgggttagcaaaaggcttttaaagccatatacaggttcaaaatcaaaggaagcccag
aagggaggtcatttttacagtgcaaagcctgaaatactgagagcaatgcaacgtgcagat
gaagccttaaataaagacaagattaagaggcttgaattggcagtttgtgatgagccctca
gagccagaagaggaagaagagatggaggtaggcacaacttacgtaacagataagagtgaa
gaagataatgaaattgagagtgaagaggaagtacagcctaagacacaaggatctaggcga
agtagccgccaaataaaaaaacgaagggtcatatcagattctgagagtgacattggtggc
tctgatgtggaatttaagccagacactaaggaggaaggaagcagtgatgaaataagcagt
ggagtgggggatagtgagagtgaaggcctgaacagccctgtcaaagttgctcgaaagcgg
aagagaatggtgactggaaatggctctcttaaaaggaaaagctctaggaaggaaacgccc
tcagccaccaaacaagcaactagcatttcatcagaaaccaagaatactttgagagctttc
tctgcccctcaaaattctgaatcccaagcccacgttagtggaggtggtgatgacagtagt
cgccctactgtttggtatcatgaaactttagaatggcttaaggaggaaaagagaagagat
gagcacaggaggaggcctgatcaccccgattttgatgcatctacactctatgtgcctgag
gatttcctcaattcttgtactcctgggatgaggaagtggtggcagattaagtctcagaac
tttgatcttgtcatctgttacaaggtggggaaattttatgagctgtaccacatggatgct
cttattggagtcagtgaactggggctggtattcatgaaaggcaactgggcccattctggc
tttcctgaaattgcatttggccgttattcagattccctggtgcagaagggctataaagta
gcacgagtggaacagactgagactccagaaatgatggaggcacgatgtagaaagatggca
catatatccaagtatgatagagtggtgaggagggagatctgtaggatcattaccaagggt
acacagacttacagtgtgctggaaggtgatccctctgagaactacagtaagtatcttctt
agcctcaaagaaaaagaggaagattcttctggccatactcgtgcatatggtgtgtgcttt
gttgatacttcactgggaaagtttttcataggtcagttttcagatgatcgccattgttcg
agatttaggactctagtggcacactatcccccagtacaagttttatttgaaaaaggaaat
ctctcaaaggaaactaaaacaattctaaagagttcattgtcctgttctcttcaggaaggt
ctgatacccggctcccagttttgggatgcatccaaaactttgagaactctccttgaggaa
gaatattttagggaaaagctaagtgatggcattggggtgatgttaccccaggtgcttaaa
ggtatgacttcagagtctgattccattgggttgacaccaggagagaaaagtgaattggcc
ctctctgctctaggtggttgtgtcttctacctcaaaaaatgccttattgatcaggagctt
ttatcaatggctaattttgaagaatatattcccttggattctgacacagtcagcactaca
agatctggtgctatcttcaccaaagcctatcaacgaatggtgctagatgcagtgacatta
aacaacttggagatttttctgaatggaacaaatggttctactgaaggaaccctactagag
agggttgatacttgccatactccttttggtaagcggctcctaaagcaatggctttgtgcc
ccactctgtaaccattatgctattaatgatcgtctagatgccatagaagacctcatggtt
gtgcctgacaaaatctccgaagttgtagagcttctaaagaagcttccagatcttgagagg
ctactcagtaaaattcataatgttgggtctcccctgaagagtcagaaccacccagacagc
agggctataatgtatgaagaaactacatacagcaagaagaagattattgattttctttct
gctctggaaggattcaaagtaatgtgtaaaattatagggatcatggaagaagttgctgat
ggttttaagtctaaaatccttaagcaggtcatctctctgcagacaaaaaatcctgaaggt
cgttttcctgatttgactgtagaattgaaccgatgggatacagcctttgaccatgaaaag
gctcgaaagactggacttattactcccaaagcaggctttgactctgattatgaccaagct
cttgctgacataagagaaaatgaacagagcctcctggaatacctagagaaacagcgcaac
agaattggctgtaggaccatagtctattgggggattggtaggaaccgttaccagctggaa
attcctgagaatttcaccactcgcaatttgccagaagaatacgagttgaaatctaccaag
aagggctgtaaacgatactggaccaaaactattgaaaagaagttggctaatctcataaat
gctgaagaacggagggatgtatcattgaaggactgcatgcggcgactgttctataacttt
gataaaaattacaaggactggcagtctgctgtagagtgtatcgcagtgttggatgtttta
ctgtgcctggctaactatagtcgagggggtgatggtcctatgtgtcgcccagtaattctg
ttgccggaagataccccccccttcttagagcttaaaggatcacgccatccttgcattacg
aagactttttttggagatgattttattcctaatgacattctaataggctgtgaggaagag
gagcaggaaaatggcaaagcctattgtgtgcttgttactggaccaaatatggggggcaag
tctacgcttatgagacaggctggcttattagctgtaatggcccagatgggttgttacgtc
cctgctgaagtgtgcaggctcacaccaattgatagagtgtttactagacttggtgcctca
gacagaataatgtcaggtgaaagtacattttttgttgaattaagtgaaactgccagcata
ctcatgcatgcaacagcacattctctggtgcttgtggatgaattaggaagaggtactgca
acatttgatgggacggcaatagcaaatgcagttgttaaagaacttgctgagactataaaa
tgtcgtacattattttcaactcactaccattcattagtagaagattattctcaaaatgtt
gctgtgcgcctaggacatatggcatgcatggtagaaaatgaatgtgaagaccccagccag
gagactattacgttcctctataaattcattaagggagcttgtcctaaaagctatggcttt
aatgcagcaaggcttgctaatctcccagaggaagttattcaaaagggacatagaaaagca
agagaatttgagaagatgaatcagtcactacgattatttcgggaagtttgcctggctagt
gaaaggtcaactgtagatgctgaagctgtccataaattgctgactttgattaaggaatta
tag

DBGET integrated database retrieval system