KEGG   Homo sapiens (human): 2956Help
Entry
2956              CDS       T01001                                 

Gene name
MSH6, GTBP, GTMBP, HNPCC5, HSAP, p160
Definition
(RefSeq) mutS homolog 6
  KO
K08737  
DNA mismatch repair protein MSH6
Organism
hsa  Homo sapiens (human)
Pathway
Mismatch repair
Pathways in cancer
Colorectal cancer
Module
BRCA1-associated genome surveillance complex (BASC)
Disease
H00020  
Colorectal cancer
H00876  
Mismatch repair deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03430 Mismatch repair
    2956 (MSH6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2956 (MSH6)
   05210 Colorectal cancer
    2956 (MSH6)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Mismatch and loop recognition factors
     2956 (MSH6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2p16
AA seq 1360 aa AA seqDB search
MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPL
ARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFI
REKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRAD
EALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRR
SSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR
KRMVTGNGSLKRKSSRKETPSATKQATSISSETKNTLRAFSAPQNSESQAHVSGGGDDSS
RPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQIKSQN
FDLVICYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQKGYKV
ARVEQTETPEMMEARCRKMAHISKYDRVVRREICRIITKGTQTYSVLEGDPSENYSKYLL
SLKEKEEDSSGHTRAYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGN
LSKETKTILKSSLSCSLQEGLIPGSQFWDASKTLRTLLEEEYFREKLSDGIGVMLPQVLK
GMTSESDSIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDTVSTT
RSGAIFTKAYQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERVDTCHTPFGKRLLKQWLCA
PLCNHYAINDRLDAIEDLMVVPDKISEVVELLKKLPDLERLLSKIHNVGSPLKSQNHPDS
RAIMYEETTYSKKKIIDFLSALEGFKVMCKIIGIMEEVADGFKSKILKQVISLQTKNPEG
RFPDLTVELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRN
RIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLIN
AEERRDVSLKDCMRRLFYNFDKNYKDWQSAVECIAVLDVLLCLANYSRGGDGPMCRPVIL
LPEDTPPFLELKGSRHPCITKTFFGDDFIPNDILIGCEEEEQENGKAYCVLVTGPNMGGK
STLMRQAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASI
LMHATAHSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSQNV
AVRLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKA
REFEKMNQSLRLFREVCLASERSTVDAEAVHKLLTLIKEL
NT seq 4083 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgacagagcaccctgtacagcttcttccccaagtctccggcgctgagtgatgcc
aacaaggcctcggccagggcctcacgcgaaggcggccgtgccgccgctgcccccggggcc
tctccttccccaggcggggatgcggcctggagcgaggctgggcctgggcccaggcccttg
gcgcgctccgcgtcaccgcccaaggcgaagaacctcaacggagggctgcggagatcggta
gcgcctgctgcccccaccagttgtgacttctcaccaggagatttggtttgggccaagatg
gagggttacccctggtggccttgtctggtttacaaccacccctttgatggaacattcatc
cgcgagaaagggaaatcagtccgtgttcatgtacagttttttgatgacagcccaacaagg
ggctgggttagcaaaaggcttttaaagccatatacaggttcaaaatcaaaggaagcccag
aagggaggtcatttttacagtgcaaagcctgaaatactgagagcaatgcaacgtgcagat
gaagccttaaataaagacaagattaagaggcttgaattggcagtttgtgatgagccctca
gagccagaagaggaagaagagatggaggtaggcacaacttacgtaacagataagagtgaa
gaagataatgaaattgagagtgaagaggaagtacagcctaagacacaaggatctaggcga
agtagccgccaaataaaaaaacgaagggtcatatcagattctgagagtgacattggtggc
tctgatgtggaatttaagccagacactaaggaggaaggaagcagtgatgaaataagcagt
ggagtgggggatagtgagagtgaaggcctgaacagccctgtcaaagttgctcgaaagcgg
aagagaatggtgactggaaatggctctcttaaaaggaaaagctctaggaaggaaacgccc
tcagccaccaaacaagcaactagcatttcatcagaaaccaagaatactttgagagctttc
tctgcccctcaaaattctgaatcccaagcccacgttagtggaggtggtgatgacagtagt
cgccctactgtttggtatcatgaaactttagaatggcttaaggaggaaaagagaagagat
gagcacaggaggaggcctgatcaccccgattttgatgcatctacactctatgtgcctgag
gatttcctcaattcttgtactcctgggatgaggaagtggtggcagattaagtctcagaac
tttgatcttgtcatctgttacaaggtggggaaattttatgagctgtaccacatggatgct
cttattggagtcagtgaactggggctggtattcatgaaaggcaactgggcccattctggc
tttcctgaaattgcatttggccgttattcagattccctggtgcagaagggctataaagta
gcacgagtggaacagactgagactccagaaatgatggaggcacgatgtagaaagatggca
catatatccaagtatgatagagtggtgaggagggagatctgtaggatcattaccaagggt
acacagacttacagtgtgctggaaggtgatccctctgagaactacagtaagtatcttctt
agcctcaaagaaaaagaggaagattcttctggccatactcgtgcatatggtgtgtgcttt
gttgatacttcactgggaaagtttttcataggtcagttttcagatgatcgccattgttcg
agatttaggactctagtggcacactatcccccagtacaagttttatttgaaaaaggaaat
ctctcaaaggaaactaaaacaattctaaagagttcattgtcctgttctcttcaggaaggt
ctgatacccggctcccagttttgggatgcatccaaaactttgagaactctccttgaggaa
gaatattttagggaaaagctaagtgatggcattggggtgatgttaccccaggtgcttaaa
ggtatgacttcagagtctgattccattgggttgacaccaggagagaaaagtgaattggcc
ctctctgctctaggtggttgtgtcttctacctcaaaaaatgccttattgatcaggagctt
ttatcaatggctaattttgaagaatatattcccttggattctgacacagtcagcactaca
agatctggtgctatcttcaccaaagcctatcaacgaatggtgctagatgcagtgacatta
aacaacttggagatttttctgaatggaacaaatggttctactgaaggaaccctactagag
agggttgatacttgccatactccttttggtaagcggctcctaaagcaatggctttgtgcc
ccactctgtaaccattatgctattaatgatcgtctagatgccatagaagacctcatggtt
gtgcctgacaaaatctccgaagttgtagagcttctaaagaagcttccagatcttgagagg
ctactcagtaaaattcataatgttgggtctcccctgaagagtcagaaccacccagacagc
agggctataatgtatgaagaaactacatacagcaagaagaagattattgattttctttct
gctctggaaggattcaaagtaatgtgtaaaattatagggatcatggaagaagttgctgat
ggttttaagtctaaaatccttaagcaggtcatctctctgcagacaaaaaatcctgaaggt
cgttttcctgatttgactgtagaattgaaccgatgggatacagcctttgaccatgaaaag
gctcgaaagactggacttattactcccaaagcaggctttgactctgattatgaccaagct
cttgctgacataagagaaaatgaacagagcctcctggaatacctagagaaacagcgcaac
agaattggctgtaggaccatagtctattgggggattggtaggaaccgttaccagctggaa
attcctgagaatttcaccactcgcaatttgccagaagaatacgagttgaaatctaccaag
aagggctgtaaacgatactggaccaaaactattgaaaagaagttggctaatctcataaat
gctgaagaacggagggatgtatcattgaaggactgcatgcggcgactgttctataacttt
gataaaaattacaaggactggcagtctgctgtagagtgtatcgcagtgttggatgtttta
ctgtgcctggctaactatagtcgagggggtgatggtcctatgtgtcgcccagtaattctg
ttgccggaagataccccccccttcttagagcttaaaggatcacgccatccttgcattacg
aagactttttttggagatgattttattcctaatgacattctaataggctgtgaggaagag
gagcaggaaaatggcaaagcctattgtgtgcttgttactggaccaaatatggggggcaag
tctacgcttatgagacaggctggcttattagctgtaatggcccagatgggttgttacgtc
cctgctgaagtgtgcaggctcacaccaattgatagagtgtttactagacttggtgcctca
gacagaataatgtcaggtgaaagtacattttttgttgaattaagtgaaactgccagcata
ctcatgcatgcaacagcacattctctggtgcttgtggatgaattaggaagaggtactgca
acatttgatgggacggcaatagcaaatgcagttgttaaagaacttgctgagactataaaa
tgtcgtacattattttcaactcactaccattcattagtagaagattattctcaaaatgtt
gctgtgcgcctaggacatatggcatgcatggtagaaaatgaatgtgaagaccccagccag
gagactattacgttcctctataaattcattaagggagcttgtcctaaaagctatggcttt
aatgcagcaaggcttgctaatctcccagaggaagttattcaaaagggacatagaaaagca
agagaatttgagaagatgaatcagtcactacgattatttcgggaagtttgcctggctagt
gaaaggtcaactgtagatgctgaagctgtccataaattgctgactttgattaaggaatta
tag

DBGET integrated database retrieval system