KEGG   Homo sapiens (human): 2997Help
Entry
2997              CDS       T01001                                 

Gene name
GYS1, GSY, GYS
Definition
(RefSeq) glycogen synthase 1 (muscle) (EC:2.4.1.11)
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
Starch and sucrose metabolism
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Disease
H00069  
Glycogen storage diseases (GSD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    2997 (GYS1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    2997 (GYS1)
   04152 AMPK signaling pathway
    2997 (GYS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    2997 (GYS1)
   04922 Glucagon signaling pathway
    2997 (GYS1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    2997 (GYS1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     2997 (GYS1)
Glycosyltransferases [BR:hsa01003]
 Polysaccharide
  Storage polysaccharide
   2997 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
19q13.3
AA seq 673 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYFLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCKFLAQSEEKPHVVAHFHEWLA
GVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYHRYCM
ERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARI
QEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTVVA
FFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLDKED
FTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSS
TSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIAD
PSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRY
YMSARHMALSKAFPEHFTYEPNEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDEEDPR
NGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSE
PLSPTSSLGEERN
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaaaccgcactttgtccatgtcctcactgccaggactggaggactgggaggat
gaattcgacctggagaacgcagtgctcttcgaagtggcctgggaggtggctaacaaggtg
ggtggcatctacacggtgctgcagacgaaggcgaaggtgacaggggacgaatggggcgac
aactacttcctggtggggccgtacacggagcagggcgtgaggacccaggtggaactgctg
gaggcccccaccccggccctgaagaggacactggattccatgaacagcaagggctgcaag
ttcctggcacagagtgaggagaagccacatgtggttgctcacttccatgagtggttggca
ggcgttggactctgcctgtgtcgtgcccggcgactgcctgtagcaaccatcttcaccacc
catgccacgctgctggggcgctacctgtgtgccggtgccgtggacttctacaacaacctg
gagaacttcaacgtggacaaggaagcaggggagaggcagatctaccaccgatactgcatg
gaaagggcggcagcccactgcgctcacgtcttcactactgtgtcccagatcaccgccatc
gaggcacagcacttgctcaagaggaaaccagatattgtgacccccaatgggctgaatgtg
aagaagttttctgccatgcatgagttccagaacctccatgctcagagcaaggctcgaatc
caggagtttgtgcggggccatttttatgggcatctggacttcaacttggacaagacctta
tacttctttatcgccggccgctatgagttctccaacaagggtgctgacgtcttcctggag
gcattggctcggctcaactatctgctcagagtgaacggcagcgagcagacagtggttgcc
ttcttcatcatgccagcgcggaccaacaatttcaacgtggaaaccctcaaaggccaagct
gtgcgcaaacagctttgggacacggccaacacggtgaaggaaaagttcgggaggaagctt
tatgaatccttactggttgggagccttcccgacatgaacaagatgctggataaggaagac
ttcactatgatgaagagagccatctttgcaacgcagcggcagtctttcccccctgtgtgc
acccacaatatgctggatgactcctcagaccccatcctgaccaccatccgccgaatcggc
ctcttcaatagcagtgccgacagggtgaaggtgattttccacccggagttcctctcctcc
acaagccccctgctccctgtggactatgaggagtttgtccgtggctgtcaccttggagtc
ttcccctcctactatgagccttggggctacacaccggctgagtgcacggttatgggaatc
cccagtatctccaccaatctctccggcttcggctgcttcatggaggaacacatcgcagac
ccctcagcttacggtatctacattcttgaccggcggttccgcagcctggatgattcctgc
tcgcagctcacctccttcctctacagtttctgtcagcagagccggcggcagcgtatcatc
cagcggaaccgcacggagcgcctctccgaccttctggactggaaatacctaggccggtac
tatatgtctgcgcgccacatggcgctgtccaaggcctttccagagcacttcacctacgag
cccaacgaggcggatgcggcccaggggtaccgctacccacggccagcctcggtgccaccg
tcgccctcgctgtcacgacactccagcccgcaccagagtgaggacgaggaggatccccgg
aacgggccgctggaggaagacggcgagcgctacgatgaggacgaggaggccgccaaggac
cggcgcaacatccgtgcaccagagtggccgcgccgagcgtcctgcacctcctccaccagc
ggcagcaagcgcaactctgtggacacggccacctccagctcactcagcaccccgagcgag
cccctcagccccaccagctccctgggcgaggagcgtaactaa

DBGET integrated database retrieval system