KEGG   Homo sapiens (human): 2998Help
Entry
2998              CDS       T01001                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04910  Insulin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
Disease
H00069  Glycogen storage diseases (GSD)
H01760  Hepatic glycogen storage disease
H01950  Glycogen storage disease type 0a
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    2998 (GYS2)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    2998 (GYS2)
   04152 AMPK signaling pathway
    2998 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    2998 (GYS2)
   04922 Glucagon signaling pathway
    2998 (GYS2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    2998 (GYS2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     2998 (GYS2)
Glycosyltransferases [BR:hsa01003]
 Polysaccharide
  Storage polysaccharide
   2998 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 2998
NCBI-ProteinID: NP_068776
OMIM: 138571
HGNC: 4707
Ensembl: ENSG00000111713
Vega: OTTHUMG00000169135
Pharos: P54840(Tbio)
UniProt: P54840
LinkDB All DBs
Position
12p12.1
AA seq 703 aa AA seqDB search
MLRGRSLSVTSLGGLPQWEVEELPVEELLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWG
ENYFLIGPYFEHNMKTQVEQCEPVNDAVRRAVDAMNKHGCQVHFGRWLIEGSPYVVLFDI
GYSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFLKEVTDHADGKYVVAQFH
EWQAGIGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSDI
TVMVFFIMPAKTNNFNVETLKGQAVRKQLWDVAHSVKEKFGKKLYDALLRGEIPDLNDIL
DRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTKFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARHLTLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVE
DEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaggccgatccctctctgtaacatccctgggtgggcttccccagtgggaagtc
gaagaacttcctgtggaggagttactgctctttgaagttgcttgggaagtgaccaataaa
gttggaggcatctatactgtgattcagacaaaggccaaaacaacagcagatgaatgggga
gagaactattttctgataggtccatattttgagcataatatgaagactcaggtggaacag
tgtgaacctgtaaatgatgctgtcagaagagcagtggacgcaatgaataagcatggctgc
caggtgcattttggaagatggctgatagaaggaagtccttatgtggtactttttgacata
ggctattcagcttggaatctggacaggtggaagggtgacctctgggaagcatgcagtgtc
ggcattccttatcatgaccgagaagccaatgatatgctgatatttggatctttaactgcc
tggttcttaaaagaggtgacagatcatgcagatggtaaatatgtcgttgcccaattccat
gaatggcaggctggaattggactgatcctttctcgagccaggaaacttcctattgccaca
atatttacaacccacgctacactacttgggaggtatctctgtgcagcaaatattgatttc
tacaaccatcttgataagtttaacattgacaaagaggctggggaaaggcagatttaccac
cggtactgcatggagcgagcttccgttcattgcgctcacgtgttcaccacggtttctgaa
ataacagcaatagaagctgaacatatgctgaagagaaagcctgatgtagttactccaaac
ggcttgaatgttaagaaattttcagcagtgcatgagtttcaaaatctacatgccatgtac
aaggccagaatccaagattttgttcgaggtcatttctatggtcatctcgactttgatctt
gaaaagactttgttccttttcattgctgggaggtatgagttttcaaacaaaggagctgac
atcttcctagaatccttatccaggctaaatttcctgctgaggatgcataaaagtgacatc
acagtgatggtgtttttcattatgcctgccaagacaaataatttcaacgtggaaaccctg
aaaggacaagcagtgcgaaaacagctgtgggatgttgcacattctgtgaaggaaaagttt
ggaaaaaaactctatgatgcattattaagaggagaaattcctgacctgaacgatatttta
gatcgagatgatctaacaattatgaaaagagccatcttttcaactcagcgacagtcattg
cccccagtgaccacgcacaacatgattgatgactccaccgaccccatcctcagcaccatt
agacggattggacttttcaacaaccgcacagatagagtcaaggtgattttgcacccagag
tttctatcctccaccagtcccttactacccatggactatgaagagtttgttagaggttgt
catcttggagtatttccatcatactatgaaccctggggttatactccagctgaatgcact
gtgatgggtatccccagtgtgaccacgaatctctccgggtttggctgtttcatgcaggag
cacgtggctgatcctactgcttacggtatttacatcgttgacaggcggttccgttctcca
gatgattcttgcaatcagctgactaagtttctctatggattttgcaaacagtcacgccgc
caaaggattatccagaggaacagaactgagaggctctcagatcttctggattggagatac
ttaggcagatattaccagcatgccagacacctgacattaagcagagcttttccagataaa
ttccatgtggaactaacatcaccaccaacgacagaaggatttaaatatcccaggccttcc
tcagtaccaccttctccttcagggtctcaggcctccagtcctcagagcagtgatgtggaa
gatgaagtggaggatgagagatacgatgaggaagaggaggctgaaagggatcggttaaat
atcaagtcaccattttcactgagccacgttcctcatgggaagaaaaagctgcatggtgaa
tataagaactga

DBGET integrated database retrieval system