KEGG   Homo sapiens (human): 3123Help
Entry
3123              CDS       T01001                                 

Gene name
HLA-DRB1, DRB1, DRw10, HLA-DR1B, HLA-DRB, SS1
Definition
major histocompatibility complex, class II, DR beta 1
Orthology
K06752  
major histocompatibility complex, class II
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Cell adhesion molecules (CAMs)
Antigen processing and presentation
Hematopoietic cell lineage
Intestinal immune network for IgA production
Type I diabetes mellitus
Leishmaniasis
Toxoplasmosis
Staphylococcus aureus infection
Tuberculosis
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Disease
H00079  
Asthma
H00080  
Systemic lupus erythematosus
H00081  
Hashimoto's thyroiditis
H00082  
Graves' disease
H00294  
Dilated cardiomyopathy (DCM)
H00342  
Tuberculosis
H00408  
Type I diabetes mellitus
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3123 (HLA-DRB1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3123 (HLA-DRB1)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3123 (HLA-DRB1)
   04612 Antigen processing and presentation
    3123 (HLA-DRB1)
   04672 Intestinal immune network for IgA production
    3123 (HLA-DRB1)
 Human Diseases
  Immune diseases
   05310 Asthma
    3123 (HLA-DRB1)
   05322 Systemic lupus erythematosus
    3123 (HLA-DRB1)
   05323 Rheumatoid arthritis
    3123 (HLA-DRB1)
   05320 Autoimmune thyroid disease
    3123 (HLA-DRB1)
   05321 Inflammatiory bowel disease (IBD)
    3123 (HLA-DRB1)
   05330 Allograft rejection
    3123 (HLA-DRB1)
   05332 Graft-versus-host disease
    3123 (HLA-DRB1)
  Cardiovascular diseases
   05416 Viral myocarditis
    3123 (HLA-DRB1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3123 (HLA-DRB1)
  Infectious diseases
   05150 Staphylococcus aureus infection
    3123 (HLA-DRB1)
   05152 Tuberculosis
    3123 (HLA-DRB1)
   05166 HTLV-I infection
    3123 (HLA-DRB1)
   05164 Influenza A
    3123 (HLA-DRB1)
   05168 Herpes simplex infection
    3123 (HLA-DRB1)
   05169 Epstein-Barr virus infection
    3123 (HLA-DRB1)
   05145 Toxoplasmosis
    3123 (HLA-DRB1)
   05140 Leishmaniasis
    3123 (HLA-DRB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3123 (HLA-DRB1)
  Exosomal proteins of epithelial cells
   3123 (HLA-DRB1)
  Exosomal proteins of breast milk
   3123 (HLA-DRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 266 aa AA seqDB search
MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRYLDRYF
HNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTV
QRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPRGFLS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgtctgaggctccctggaggctcctgcatggcagttctgacagtgacactgatg
gtgctgagctccccactggctttggctggggacaccagaccacgtttcttggagtactct
acgtctgagtgtcatttcttcaatgggacggagcgggtgcggtacctggacagatacttc
cataaccaggaggagaacgtgcgcttcgacagcgacgtgggggagttccgggcggtgacg
gagctggggcggcctgatgccgagtactggaacagccagaaggacctcctggagcagaag
cggggccgggtggacaactactgcagacacaactacggggttgtggagagcttcacagtg
cagcggcgagtccatcctaaggtgactgtgtatccttcaaagacccagcccctgcagcac
cataacctcctggtctgttctgtgagtggtttctatccaggcagcattgaagtcaggtgg
ttccggaatggccaggaagagaagactggggtggtgtccacaggcctgatccacaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcggagtggagaggtttac
acctgccaagtggagcacccaagcgtgacaagccctctcacagtggaatggagagcacgg
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttggggccgggctgttcatctacttcaggaatcagaaaggacactctggacttcag
ccaagaggattcctgagctga

DBGET integrated database retrieval system