KEGG   Homo sapiens (human): 3248Help
Entry
3248              CDS       T01001                                 

Gene name
HPGD, 15-PGDH, PGDH, PGDH1, PHOAR1, SDR36C1
Definition
hydroxyprostaglandin dehydrogenase 15-(NAD) (EC:1.1.1.141)
Orthology
K00069  
15-hydroxyprostaglandin dehydrogenase (NAD) [EC:1.1.1.141]
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Disease
H00457  
Primary hypertrophic osteoarthropathy (PHO)
H01246  
Isolated congenital nail clubbing (ICNC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    3248 (HPGD)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.141  15-hydroxyprostaglandin dehydrogenase (NAD+)
     3248 (HPGD)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3248 (HPGD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4q34-q35
AA seq 266 aa AA seqDB search
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLF
IQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLD
YMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNA
ICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNG
AIMKITTSKGIHFQDYDTTPFQAKTQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgaacggcaaagtggcgctggtgaccggcgcggctcagggcataggcagagcc
tttgcagaggcgctgctgcttaagggcgccaaggtagcgctggtggattggaatcttgaa
gcaggtgtacagtgtaaagctgccctggatgagcagtttgaacctcagaagactctgttc
atccagtgcgatgtggctgaccagcaacaactgagagacacttttagaaaagttgtagac
cactttggaagactggacattttggtcaataatgctggagtgaataatgagaaaaactgg
gaaaaaactctgcaaattaatttggtttctgttatcagtggaacctatcttggtttggat
tacatgagtaagcaaaatggaggtgaaggcggcatcattatcaatatgtcatctttagca
ggactcatgcccgttgcacagcagccggtttattgtgcttcaaagcatggcatagttgga
ttcacacgctcagcagcgttggctgctaatcttatgaacagtggtgtgagactgaatgcc
atttgtccaggctttgttaacacagccatccttgaatcaattgaaaaagaagaaaacatg
ggacaatatatagaatataaggatcatatcaaggatatgattaaatactatggaattttg
gacccaccattgattgccaatggattgataacactcattgaagatgatgctttaaatggt
gctattatgaagatcacaacttctaagggaattcattttcaagactatgatacaactcca
tttcaagcaaaaacccaatga

DBGET integrated database retrieval system