KEGG   Homo sapiens (human): 3251Help
Entry
3251              CDS       T01001                                 

Gene name
HPRT1, HGPRT, HPRT
Definition
hypoxanthine phosphoribosyltransferase 1 (EC:2.4.2.8)
Orthology
K00760  
hypoxanthine phosphoribosyltransferase [EC:2.4.2.8]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Disease
H00194  
Lesch-Nyhan syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    3251 (HPRT1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    3251 (HPRT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.8  hypoxanthine phosphoribosyltransferase
     3251 (HPRT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
Xq26.1
AA seq 218 aa AA seqDB search
MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcgacccgcagccctggcgtcgtgattagtgatgatgaaccaggttatgaccttgat
ttattttgcatacctaatcattatgctgaggatttggaaagggtgtttattcctcatgga
ctaattatggacaggactgaacgtcttgctcgagatgtgatgaaggagatgggaggccat
cacattgtagccctctgtgtgctcaaggggggctataaattctttgctgacctgctggat
tacatcaaagcactgaatagaaatagtgatagatccattcctatgactgtagattttatc
agactgaagagctattgtaatgaccagtcaacaggggacataaaagtaattggtggagat
gatctctcaactttaactggaaagaatgtcttgattgtggaagatataattgacactggc
aaaacaatgcagactttgctttccttggtcaggcagtataatccaaagatggtcaaggtc
gcaagcttgctggtgaaaaggaccccacgaagtgttggatataagccagactttgttgga
tttgaaattccagacaagtttgttgtaggatatgcccttgactataatgaatacttcagg
gatttgaatcatgtttgtgtcattagtgaaactggaaaagcaaaatacaaagcctaa

DBGET integrated database retrieval system