KEGG   Homo sapiens (human): 3251Help
Entry
3251              CDS       T01001                                 

Gene name
HPRT1, HGPRT, HPRT
Definition
hypoxanthine phosphoribosyltransferase 1 (EC:2.4.2.8)
Orthology
K00760  
hypoxanthine phosphoribosyltransferase [EC:2.4.2.8]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Disease
H00194  
Lesch-Nyhan syndrome
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hsa00230]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:hsa00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
Xq26.1
AA seq 218 aa AA seqDB search
MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcgacccgcagccctggcgtcgtgattagtgatgatgaaccaggttatgaccttgat
ttattttgcatacctaatcattatgctgaggatttggaaagggtgtttattcctcatgga
ctaattatggacaggactgaacgtcttgctcgagatgtgatgaaggagatgggaggccat
cacattgtagccctctgtgtgctcaaggggggctataaattctttgctgacctgctggat
tacatcaaagcactgaatagaaatagtgatagatccattcctatgactgtagattttatc
agactgaagagctattgtaatgaccagtcaacaggggacataaaagtaattggtggagat
gatctctcaactttaactggaaagaatgtcttgattgtggaagatataattgacactggc
aaaacaatgcagactttgctttccttggtcaggcagtataatccaaagatggtcaaggtc
gcaagcttgctggtgaaaaggaccccacgaagtgttggatataagccagactttgttgga
tttgaaattccagacaagtttgttgtaggatatgcccttgactataatgaatacttcagg
gatttgaatcatgtttgtgtcattagtgaaactggaaaagcaaaatacaaagcctaa

DBGET integrated database retrieval system