KEGG   Homo sapiens (human): 335Help
Entry
335               CDS       T01001                                 

Gene name
APOA1
Definition
apolipoprotein A-I
Orthology
K08757  
apolipoprotein A-I
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Fat digestion and absorption
Vitamin digestion and absorption
African trypanosomiasis
Disease
H00845  
Familial amyloidosis
H00930  
Hypoalphalipoproteinemia
Class
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
Organismal Systems; Digestive system; Fat digestion and absorption [PATH:hsa04975]
Organismal Systems; Digestive system; Vitamin digestion and absorption [PATH:hsa04977]
Human Diseases; Infectious diseases; African trypanosomiasis [PATH:hsa05143]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
11q23-q24
AA seq 267 aa AA seqDB search
MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGS
ALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAK
VQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHV
DALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQ
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcggtgctgaccttggccgtgctcttcctgacggggagccaggctcggcat
ttctggcagcaagatgaacccccccagagcccctgggatcgagtgaaggacctggccact
gtgtacgtggatgtgctcaaagacagcggcagagactatgtgtcccagtttgaaggctcc
gccttgggaaaacagctaaacctaaagctccttgacaactgggacagcgtgacctccacc
ttcagcaagctgcgcgaacagctcggccctgtgacccaggagttctgggataacctggaa
aaggagacagagggcctgaggcaggagatgagcaaggatctggaggaggtgaaggccaag
gtgcagccctacctggacgacttccagaagaagtggcaggaggagatggagctctaccgc
cagaaggtggagccgctgcgcgcagagctccaagagggcgcgcgccagaagctgcacgag
ctgcaagagaagctgagcccactgggcgaggagatgcgcgaccgcgcgcgcgcccatgtg
gacgcgctgcgcacgcatctggccccctacagcgacgagctgcgccagcgcttggccgcg
cgccttgaggctctcaaggagaacggcggcgccagactggccgagtaccacgccaaggcc
accgagcatctgagcacgctcagcgagaaggccaagcccgcgctcgaggacctccgccaa
ggcctgctgcccgtgctggagagcttcaaggtcagcttcctgagcgctctcgaggagtac
actaagaagctcaacacccagtga

DBGET integrated database retrieval system