KEGG   Homo sapiens (human): 335Help
Entry
335               CDS       T01001                                 

Gene name
APOA1
Definition
apolipoprotein A-I
Orthology
K08757  
apolipoprotein A-I
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Fat digestion and absorption
Vitamin digestion and absorption
African trypanosomiasis
Disease
H00845  
Familial amyloidosis
H00930  
Hypoalphalipoproteinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    335 (APOA1)
  Digestive system
   04975 Fat digestion and absorption
    335 (APOA1)
   04977 Vitamin digestion and absorption
    335 (APOA1)
 Human Diseases
  Infectious diseases
   05143 African trypanosomiasis
    335 (APOA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   335 (APOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
11q23-q24
AA seq 267 aa AA seqDB search
MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGS
ALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAK
VQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHV
DALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQ
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcggtgctgaccttggccgtgctcttcctgacggggagccaggctcggcat
ttctggcagcaagatgaacccccccagagcccctgggatcgagtgaaggacctggccact
gtgtacgtggatgtgctcaaagacagcggcagagactatgtgtcccagtttgaaggctcc
gccttgggaaaacagctaaacctaaagctccttgacaactgggacagcgtgacctccacc
ttcagcaagctgcgcgaacagctcggccctgtgacccaggagttctgggataacctggaa
aaggagacagagggcctgaggcaggagatgagcaaggatctggaggaggtgaaggccaag
gtgcagccctacctggacgacttccagaagaagtggcaggaggagatggagctctaccgc
cagaaggtggagccgctgcgcgcagagctccaagagggcgcgcgccagaagctgcacgag
ctgcaagagaagctgagcccactgggcgaggagatgcgcgaccgcgcgcgcgcccatgtg
gacgcgctgcgcacgcatctggccccctacagcgacgagctgcgccagcgcttggccgcg
cgccttgaggctctcaaggagaacggcggcgccagactggccgagtaccacgccaaggcc
accgagcatctgagcacgctcagcgagaaggccaagcccgcgctcgaggacctccgccaa
ggcctgctgcccgtgctggagagcttcaaggtcagcttcctgagcgctctcgaggagtac
actaagaagctcaacacccagtga

DBGET integrated database retrieval system