KEGG   Homo sapiens (human): 351Help
Entry
351               CDS       T01001                                 

Gene name
APP, AAA, ABETA, ABPP, AD1, APPI, CTFgamma, CVAP, PN-II, PN2
Definition
amyloid beta (A4) precursor protein
Orthology
K04520  
amyloid beta A4 protein
Organism
hsa  Homo sapiens (human)
Pathway
Serotonergic synapse
Alzheimer's disease
Disease
H00056  
Alzheimer's disease (AD)
H01185  
Cerebral amyloid angiopathy (CAA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    351 (APP)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    351 (APP)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Others
  351 (APP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
21q21.3
AA seq 770 aa AA seqDB search
MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTK
TCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVG
EFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFR
GVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEE
EADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPC
RAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARD
PVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQA
KNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITAL
QAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYER
MNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTET
KTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTN
IKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccggtttggcactgctcctgctggccgcctggacggctcgggcgctggaggta
cccactgatggtaatgctggcctgctggctgaaccccagattgccatgttctgtggcaga
ctgaacatgcacatgaatgtccagaatgggaagtgggattcagatccatcagggaccaaa
acctgcattgataccaaggaaggcatcctgcagtattgccaagaagtctaccctgaactg
cagatcaccaatgtggtagaagccaaccaaccagtgaccatccagaactggtgcaagcgg
ggccgcaagcagtgcaagacccatccccactttgtgattccctaccgctgcttagttggt
gagtttgtaagtgatgcccttctcgttcctgacaagtgcaaattcttacaccaggagagg
atggatgtttgcgaaactcatcttcactggcacaccgtcgccaaagagacatgcagtgag
aagagtaccaacttgcatgactacggcatgttgctgccctgcggaattgacaagttccga
ggggtagagtttgtgtgttgcccactggctgaagaaagtgacaatgtggattctgctgat
gcggaggaggatgactcggatgtctggtggggcggagcagacacagactatgcagatggg
agtgaagacaaagtagtagaagtagcagaggaggaagaagtggctgaggtggaagaagaa
gaagccgatgatgacgaggacgatgaggatggtgatgaggtagaggaagaggctgaggaa
ccctacgaagaagccacagagagaaccaccagcattgccaccaccaccaccaccaccaca
gagtctgtggaagaggtggttcgagaggtgtgctctgaacaagccgagacggggccgtgc
cgagcaatgatctcccgctggtactttgatgtgactgaagggaagtgtgccccattcttt
tacggcggatgtggcggcaaccggaacaactttgacacagaagagtactgcatggccgtg
tgtggcagcgccatgtcccaaagtttactcaagactacccaggaacctcttgcccgagat
cctgttaaacttcctacaacagcagccagtacccctgatgccgttgacaagtatctcgag
acacctggggatgagaatgaacatgcccatttccagaaagccaaagagaggcttgaggcc
aagcaccgagagagaatgtcccaggtcatgagagaatgggaagaggcagaacgtcaagca
aagaacttgcctaaagctgataagaaggcagttatccagcatttccaggagaaagtggaa
tctttggaacaggaagcagccaacgagagacagcagctggtggagacacacatggccaga
gtggaagccatgctcaatgaccgccgccgcctggccctggagaactacatcaccgctctg
caggctgttcctcctcggcctcgtcacgtgttcaatatgctaaagaagtatgtccgcgca
gaacagaaggacagacagcacaccctaaagcatttcgagcatgtgcgcatggtggatccc
aagaaagccgctcagatccggtcccaggttatgacacacctccgtgtgatttatgagcgc
atgaatcagtctctctccctgctctacaacgtgcctgcagtggccgaggagattcaggat
gaagttgatgagctgcttcagaaagagcaaaactattcagatgacgtcttggccaacatg
attagtgaaccaaggatcagttacggaaacgatgctctcatgccatctttgaccgaaacg
aaaaccaccgtggagctccttcccgtgaatggagagttcagcctggacgatctccagccg
tggcattcttttggggctgactctgtgccagccaacacagaaaacgaagttgagcctgtt
gatgcccgccctgctgccgaccgaggactgaccactcgaccaggttctgggttgacaaat
atcaagacggaggagatctctgaagtgaagatggatgcagaattccgacatgactcagga
tatgaagttcatcatcaaaaattggtgttctttgcagaagatgtgggttcaaacaaaggt
gcaatcattggactcatggtgggcggtgttgtcatagcgacagtgatcgtcatcaccttg
gtgatgctgaagaagaaacagtacacatccattcatcatggtgtggtggaggttgacgcc
gctgtcaccccagaggagcgccacctgtccaagatgcagcagaacggctacgaaaatcca
acctacaagttctttgagcagatgcagaactag

DBGET integrated database retrieval system