KEGG   Homo sapiens (human): 353Help
Entry
353               CDS       T01001                                 

Gene name
APRT, AMP, APRTD
Definition
adenine phosphoribosyltransferase (EC:2.4.2.7)
Orthology
K00759  
adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Metabolic pathways
Disease
H00195  
Adenine phosphoribosyltransferase deficiency
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hsa00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
16q24
AA seq 180 aa AA seqDB search
MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDY
IAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPG
QRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggccgactccgagctgcagctggttgagcagcggatccgcagcttccccgacttcccc
accccaggcgtggtattcagggacatctcgcccgtcctgaaggaccccgcctccttccgc
gccgccatcggcctcctggcgcgacacctgaaggcgacccacgggggccgcatcgactac
atcgcaggcctagactcccgaggcttcctctttggcccctccctggcccaggagcttgga
ctgggctgcgtgctcatccgaaagcgggggaagctgccaggccccactctgtgggcctcc
tattccctggagtacgggaaggctgagctggagattcagaaagacgccctggagccagga
cagagggtggtcgtcgtggatgatctgctggccactggtggaaccatgaacgctgcctgt
gagctgctgggccgcctgcaggctgaggtcctggagtgcgtgagcctggtggagctgacc
tcgcttaagggcagggagaagctggcacctgtacccttcttctctctcctgcagtatgag
tga

DBGET integrated database retrieval system