KEGG   Homo sapiens (human): 3553Help
Entry
3553              CDS       T01001                                 

Gene name
IL1B, IL-1, IL1-BETA, IL1F2
Definition
interleukin 1, beta
Orthology
K04519  
interleukin 1 beta
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Hematopoietic cell lineage
TNF signaling pathway
Inflammatory mediator regulation of TRP channels
Non-alcoholic fatty liver disease (NAFLD)
Type I diabetes mellitus
Alzheimer's disease
Prion diseases
Salmonella infection
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Amoebiasis
Tuberculosis
Measles
Influenza A
Herpes simplex infection
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Graft-versus-host disease
Drug target
Rilonacept: 
Canakinumab: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    3553 (IL1B)
   04064 NF-kappa B signaling pathway
    3553 (IL1B)
   04668 TNF signaling pathway
    3553 (IL1B)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3553 (IL1B)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    3553 (IL1B)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3553 (IL1B)
   04620 Toll-like receptor signaling pathway
    3553 (IL1B)
   04621 NOD-like receptor signaling pathway
    3553 (IL1B)
   04623 Cytosolic DNA-sensing pathway
    3553 (IL1B)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3553 (IL1B)
  Development
   04380 Osteoclast differentiation
    3553 (IL1B)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    3553 (IL1B)
   05321 Inflammatiory bowel disease (IBD)
    3553 (IL1B)
   05332 Graft-versus-host disease
    3553 (IL1B)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    3553 (IL1B)
   05020 Prion diseases
    3553 (IL1B)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3553 (IL1B)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3553 (IL1B)
  Infectious diseases
   05132 Salmonella infection
    3553 (IL1B)
   05133 Pertussis
    3553 (IL1B)
   05134 Legionellosis
    3553 (IL1B)
   05152 Tuberculosis
    3553 (IL1B)
   05162 Measles
    3553 (IL1B)
   05164 Influenza A
    3553 (IL1B)
   05168 Herpes simplex infection
    3553 (IL1B)
   05146 Amoebiasis
    3553 (IL1B)
   05144 Malaria
    3553 (IL1B)
   05140 Leishmaniasis
    3553 (IL1B)
   05142 Chagas disease (American trypanosomiasis)
    3553 (IL1B)
   05143 African trypanosomiasis
    3553 (IL1B)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Cytokines (General comment) Chemotaxis, singal transduction, inflammation
  3553 (IL1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2q14
AA seq 269 aa AA seqDB search
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtacctgagctcgccagtgaaatgatggcttattacagtggcaatgaggat
gacttgttctttgaagctgatggccctaaacagatgaagtgctccttccaggacctggac
ctctgccctctggatggcggcatccagctacgaatctccgaccaccactacagcaagggc
ttcaggcaggccgcgtcagttgttgtggccatggacaagctgaggaagatgctggttccc
tgcccacagaccttccaggagaatgacctgagcaccttctttcccttcatctttgaagaa
gaacctatcttcttcgacacatgggataacgaggcttatgtgcacgatgcacctgtacga
tcactgaactgcacgctccgggactcacagcaaaaaagcttggtgatgtctggtccatat
gaactgaaagctctccacctccagggacaggatatggagcaacaagtggtgttctccatg
tcctttgtacaaggagaagaaagtaatgacaaaatacctgtggccttgggcctcaaggaa
aagaatctgtacctgtcctgcgtgttgaaagatgataagcccactctacagctggagagt
gtagatcccaaaaattacccaaagaagaagatggaaaagcgatttgtcttcaacaagata
gaaatcaataacaagctggaatttgagtctgcccagttccccaactggtacatcagcacc
tctcaagcagaaaacatgcccgtcttcctgggagggaccaaaggcggccaggatataact
gacttcaccatgcaatttgtgtcttcctaa

DBGET integrated database retrieval system