KEGG   Homo sapiens (human): 3559Help
Entry
3559              CDS       T01001                                 

Gene name
IL2RA, CD25, IDDM10, IL2R, TCGFR, p55
Definition
interleukin 2 receptor, alpha
Orthology
K05068  
interleukin 2 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Endocytosis
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Hematopoietic cell lineage
Measles
HTLV-I infection
Disease
H00091  
T-B+Severe combined immunodeficiencies (SCIDs)
H00408  
Type I diabetes mellitus
Drug target
Denileukin diftitox: 
Aldesleukin: 
Daclizumab: 
Basiliximab: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3559 (IL2RA)
   04151 PI3K-Akt signaling pathway
    3559 (IL2RA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3559 (IL2RA)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3559 (IL2RA)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3559 (IL2RA)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    3559 (IL2RA)
   05162 Measles
    3559 (IL2RA)
Cellular antigens [BR:hsa04090]
 Proteins
  3559 (IL2RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
10p15-p14
AA seq 272 aa AA seqDB search
MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKS
GSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS
LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP
QLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggattcatacctgctgatgtggggactgctcacgttcatcatggtgcctggctgccag
gcagagctctgtgacgatgacccgccagagatcccacacgccacattcaaagccatggcc
tacaaggaaggaaccatgttgaactgtgaatgcaagagaggtttccgcagaataaaaagc
gggtcactctatatgctctgtacaggaaactctagccactcgtcctgggacaaccaatgt
caatgcacaagctctgccactcggaacacaacgaaacaagtgacacctcaacctgaagaa
cagaaagaaaggaaaaccacagaaatgcaaagtccaatgcagccagtggaccaagcgagc
cttccaggtcactgcagggaacctccaccatgggaaaatgaagccacagagagaatttat
catttcgtggtggggcagatggtttattatcagtgcgtccagggatacagggctctacac
agaggtcctgctgagagcgtctgcaaaatgacccacgggaagacaaggtggacccagccc
cagctcatatgcacaggtgaaatggagaccagtcagtttccaggtgaagagaagcctcag
gcaagccccgaaggccgtcctgagagtgagacttcctgcctcgtcacaacaacagatttt
caaatacagacagaaatggctgcaaccatggagacgtccatatttacaacagagtaccag
gtagcagtggccggctgtgttttcctgctgatcagcgtcctcctcctgagtgggctcacc
tggcagcggagacagaggaagagtagaagaacaatctag

DBGET integrated database retrieval system