KEGG   Homo sapiens (human): 3560Help
Entry
3560              CDS       T01001                                 

Gene name
IL2RB, CD122, IL15RB, P70-75
Definition
(RefSeq) interleukin 2 receptor subunit beta
  KO
K05069  
interleukin 2 receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Endocytosis
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Th1 and Th2 cell differentiation
Measles
HTLV-I infection
Transcriptional misregulation in cancer
Drug target
Aldesleukin: 
Celmoleukin: 
Denileukin diftitox: 
Teceleukin: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3560 (IL2RB)
   04151 PI3K-Akt signaling pathway
    3560 (IL2RB)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3560 (IL2RB)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3560 (IL2RB)
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    3560 (IL2RB)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    3560 (IL2RB)
  Infectious diseases
   05166 HTLV-I infection
    3560 (IL2RB)
   05162 Measles
    3560 (IL2RB)
Cytokine receptors [BR:hsa04050]
 Class I cytokine receptor (hematopoietin family receptor)
  3560 (IL2RB)
Cellular antigens [BR:hsa04090]
 Proteins
  3560 (IL2RB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
22q13.1
AA seq 551 aa AA seqDB search
MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQ
VHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMA
IQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEE
APLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDT
IPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDV
QKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFT
NQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCT
FPSRDDLLLFSPSLLGGPSPPSTAPGGSGAGEERMPPSLQERVPRDWDPQPLGPPTPGVP
DLVDFQPPPELVLREAGEEVPDAGPREGVSFPWSRPPGQGEFRALNARLPLNTDAYLSLQ
ELQGQDPTHLV
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccctgctctgtcctggcgtctgcccctcctcatcctcctcctgcccctggct
acctcttgggcatctgcagcggtgaatggcacttcccagttcacatgcttctacaactcg
agagccaacatctcctgtgtctggagccaagatggggctctgcaggacacttcctgccaa
gtccatgcctggccggacagacggcggtggaaccaaacctgtgagctgctccccgtgagt
caagcatcctgggcctgcaacctgatcctcggagccccagattctcagaaactgaccaca
gttgacatcgtcaccctgagggtgctgtgccgtgagggggtgcgatggagggtgatggcc
atccaggacttcaagccctttgagaaccttcgcctgatggcccccatctccctccaagtt
gtccacgtggagacccacagatgcaacataagctgggaaatctcccaagcctcccactac
tttgaaagacacctggagttcgaggcccggacgctgtccccaggccacacctgggaggag
gcccccctgctgactctcaagcagaagcaggaatggatctgcctggagacgctcacccca
gacacccagtatgagtttcaggtgcgggtcaagcctctgcaaggcgagttcacgacctgg
agcccctggagccagcccctggccttcaggacaaagcctgcagcccttgggaaggacacc
attccgtggctcggccacctcctcgtgggcctcagcggggcttttggcttcatcatctta
gtgtacttgctgatcaactgcaggaacaccgggccatggctgaagaaggtcctgaagtgt
aacaccccagacccctcgaagttcttttcccagctgagctcagagcatggaggagacgtc
cagaagtggctctcttcgcccttcccctcatcgtccttcagccctggcggcctggcacct
gagatctcgccactagaagtgctggagagggacaaggtgacgcagctgctcctgcagcag
gacaaggtgcctgagcccgcatccttaagcagcaaccactcgctgaccagctgcttcacc
aaccagggttacttcttcttccacctcccggatgccttggagatagaggcctgccaggtg
tactttacttacgacccctactcagaggaagaccctgatgagggtgtggccggggcaccc
acagggtcttccccccaacccctgcagcctctgtcaggggaggacgacgcctactgcacc
ttcccctccagggatgacctgctgctcttctcccccagtctcctcggtggccccagcccc
ccaagcactgcccctgggggcagtggggccggtgaagagaggatgcccccttctttgcaa
gaaagagtccccagagactgggacccccagcccctggggcctcccaccccaggagtccca
gacctggtggattttcagccaccccctgagctggtgctgcgagaggctggggaggaggtc
cctgacgctggccccagggagggagtcagtttcccctggtccaggcctcctgggcagggg
gagttcagggcccttaatgctcgcctgcccctgaacactgatgcctacttgtccctccaa
gaactccagggtcaggacccaactcacttggtgtag

DBGET integrated database retrieval system