KEGG   Homo sapiens (human): 3576Help
Entry
3576              CDS       T01001                                 

Gene name
CXCL8, GCP-1, GCP1, IL8, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1
Definition
chemokine (C-X-C motif) ligand 8
Orthology
K10030  
interleukin 8
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
NF-kappa B signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Salmonella infection
Pertussis
Legionellosis
Chagas disease (American trypanosomiasis)
Malaria
Amoebiasis
Hepatitis C
Hepatitis B
Influenza A
Pathways in cancer
Transcriptional misregulation in cancer
Bladder cancer
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    3576 (CXCL8)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3576 (CXCL8)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    3576 (CXCL8)
   04621 NOD-like receptor signaling pathway
    3576 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    3576 (CXCL8)
   04062 Chemokine signaling pathway
    3576 (CXCL8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3576 (CXCL8)
   05202 Transcriptional misregulation in cancers
    3576 (CXCL8)
   05219 Bladder cancer
    3576 (CXCL8)
  Immune diseases
   05323 Rheumatoid arthritis
    3576 (CXCL8)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3576 (CXCL8)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3576 (CXCL8)
   05132 Salmonella infection
    3576 (CXCL8)
   05131 Shigellosis
    3576 (CXCL8)
   05133 Pertussis
    3576 (CXCL8)
   05134 Legionellosis
    3576 (CXCL8)
   05164 Influenza A
    3576 (CXCL8)
   05161 Hepatitis B
    3576 (CXCL8)
   05160 Hepatitis C
    3576 (CXCL8)
   05146 Amoebiasis
    3576 (CXCL8)
   05144 Malaria
    3576 (CXCL8)
   05142 Chagas disease (American trypanosomiasis)
    3576 (CXCL8)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Chemokines (General comment) Chemokine presentation, transcellular transport, signal transduction
  3576 (CXCL8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4q13-q21
AA seq 99 aa AA seqDB search
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgacttccaagctggccgtggctctcttggcagccttcctgatttctgcagctctgtgt
gaaggtgcagttttgccaaggagtgctaaagaacttagatgtcagtgcataaagacatac
tccaaacctttccaccccaaatttatcaaagaactgagagtgattgagagtggaccacac
tgcgccaacacagaaattattgtaaagctttctgatggaagagagctctgtctggacccc
aaggaaaactgggtgcagagggttgtggagaagtttttgaagagggctgagaattcataa

DBGET integrated database retrieval system