KEGG   Homo sapiens (human): 3576Help
Entry
3576              CDS       T01001                                 

Gene name
IL8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1
Definition
interleukin 8
Orthology
K10030  
interleukin 8
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
NF-kappa B signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Salmonella infection
Pertussis
Legionellosis
Chagas disease (American trypanosomiasis)
Malaria
Amoebiasis
Hepatitis C
Hepatitis B
Influenza A
Pathways in cancer
Transcriptional misregulation in cancer
Bladder cancer
Rheumatoid arthritis
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:hsa04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:hsa04622]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Cancers; Bladder cancer [PATH:hsa05219]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
Human Diseases; Infectious diseases; Epithelial cell signaling in Helicobacter pylori infection [PATH:hsa05120]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
Human Diseases; Infectious diseases; Legionellosis [PATH:hsa05134]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
Human Diseases; Infectious diseases; Malaria [PATH:hsa05144]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4q13-q21
AA seq 99 aa AA seqDB search
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgacttccaagctggccgtggctctcttggcagccttcctgatttctgcagctctgtgt
gaaggtgcagttttgccaaggagtgctaaagaacttagatgtcagtgcataaagacatac
tccaaacctttccaccccaaatttatcaaagaactgagagtgattgagagtggaccacac
tgcgccaacacagaaattattgtaaagctttctgatggaagagagctctgtctggacccc
aaggaaaactgggtgcagagggttgtggagaagtttttgaagagggctgagaattcataa

DBGET integrated database retrieval system